KEGG   Arachis ipaensis: 107631418Help
Entry
107631418         CDS       T04301                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
aip  Arachis ipaensis
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aip00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    107631418
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107631418
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107631418
   00430 Taurine and hypotaurine metabolism
    107631418
Enzymes [BR:aip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107631418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
B03
AA seq 500 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRTSLPRFKMPEESIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKEEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVDLVDENTICVAAILGSTLNGEFEDVKRLNDLLIQKNNQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKDDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVMENCRDNMLVLKDGLEK
TGRFDIVSKDDGVPLVAFTLKDSSRFNEFQVSDLLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVADVEKVLHELDMLPPKVVAVNGEEAATSSNGKVKKTALETQREITA
VWKKFVLERKKLNDKMNGVC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtcgaagacggcatctgagagcgacgtctccgtgcactcaacgtttgcgtca
cgctatgtgaggacctcacttcccaggttcaagatgccggaggagtcgatccccaaagac
gccgcgtaccagataataaatgacgagctgatgctggacggaaatcccagactgaacttg
gcgtcgttcgtgacgacgtggatggaaccggagtgcgacaagctgataatggctgccatt
aacaagaactacgttgacatggatgaataccctgtcaccactgagctccagaatcggtgt
gtaaacatgatagctcatctattcaatgcgccacttggagattcagaaactgccgttggt
gttgggacggttggatcatcggaggccataatgctggctggattggcattcaaaagaaaa
tggcagaacaaaaggaaagaagaaggtaagccttatgacaagcccaacattgtgaccggt
gccaatgtccaggtttgctgggagaaattcgcaaggtactttgaggtggagttgaaggag
gtgaagctccgtgatggatactatgttatggaccctgaaaaggctgtggacttggttgat
gagaacaccatttgcgttgctgctattcttggttccaccctcaacggtgagtttgaagat
gtcaagcgcttaaatgatcttctcattcaaaagaacaatcaaaccggctgggatactcct
attcatgttgatgctgccagtggtggattcattgctccgtttctatatcccgagcttgag
tgggacttccggttaccgctggtcaagagtatcaatgtcagcggccacaagtacggtcta
gtttacgccggaattggctgggttatctggagaagcaaggatgacctgcctgaggaactc
atcttccacatcaactatctcggagctgatcaacccacattcactcttaacttctccaaa
ggttccagtcaagtcattgctcaatactaccaactaattcgccttggttatgagggatat
aaaaatgtgatggaaaattgtagggacaacatgttagtgctcaaggatggacttgagaaa
acagggcgctttgacattgtttccaaggacgatggtgttcctttggtggccttcacactc
aaagacagcagccgcttcaatgaattccaagtctctgacttgctcaggcgctttggctgg
atagtgccggcatacaccatgcccccggatgcacagcatgttaccgttctccgcgtggtc
atccgggaggacttctccaggaccctcgcagagcgccttgtggctgatgtggagaaggtg
cttcacgagcttgatatgcttccccccaaggtagttgcggttaatggagaagaggcagca
acaagctctaatggcaaggttaagaagactgctctggagacacagagggagatcactgca
gtttggaagaagtttgtactggaaaggaagaagctgaatgacaagatgaatggggtttgt
tga

DBGET integrated database retrieval system