KEGG   Amycolatopsis japonica: AJAP_06695Help
Entry
AJAP_06695        CDS       T03225                                 

Gene name
kynU
Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
aja  Amycolatopsis japonica
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aja00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    AJAP_06695 (kynU)
Enzymes [BR:aja01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AJAP_06695 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1327289..1328470
Genome map
AA seq 393 aa AA seqDB search
MVAVTDLVAEAAALDAADPLAHKRNDFDLDAGVAYFDGNSLGAPPKHVAGRLAAVVREQW
GGRLIRSWSEGWWEAPVRVGGRIAPLVGAAPGQVVVADSTSVNLFKALVAATRLQPGRDE
ILVDADTFPTDGYIADEAARLTGRTVRRVVAEDMPAQVSERTAVALINHVDYVTGRAHDL
AGLTAALHRAGALALWDLCHSVGALPVELDAAGVDLAVGCTYKFLNGGPGAPAFLYVATK
WLDRFEQPLAGWAGDRDPFAMRGAYEAHAGIERGRAGTPDMLSLLALDAALDVWDGVDRG
VLREKGLALGDFFFRCADELLGGAKIPTPRGRDRGHQISVIDDDAAETMAALIDRGVIGD
FRPPNVLRFGLAPLYTTYGEVLRAVTTLRDLRG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgtgactgacctcgtagccgaggccgcggcgctggacgcggccgatcccttg
gcgcacaagcgaaacgacttcgacctcgacgcgggcgtcgcctatttcgacggcaactcg
ctgggcgccccgccgaaacacgtggccggacggctcgccgcggtcgtccgcgagcaatgg
ggcggccggctcatccggtcctggtcggagggctggtgggaggcgccggtacgggtcggc
gggcggatcgcgccgctcgtgggcgcggcgccgggtcaggtcgtcgtggcggactcgacg
agtgtgaacctgttcaaggcactggtcgccgccacccggctccagcccggccgcgacgag
atcctcgtcgacgccgacaccttcccgaccgacggctacatcgccgacgaggccgcccgg
ctgaccgggcgcacggtgcgccgggtggtcgccgaggacatgcccgcccaggtgagcgag
cggacggccgtcgcgctgatcaaccacgtcgactacgtcaccgggcgcgcgcacgacctg
gccgggctgaccgcggcactgcaccgcgccggggcgctggcgctctgggacctctgccac
agcgtcggcgcgctgccggtcgagctggacgcggcaggcgtggacctcgccgtcggctgc
acctacaaattcctcaacggcggccccggcgcgcccgctttcctttacgtggcgacgaaa
tggctggaccgcttcgagcagccactggcgggctgggcgggtgaccgcgacccgttcgcg
atgcggggcgcgtacgaggcgcacgccggtatcgagcgtggccgcgcgggcacgcccgac
atgctttcgctgctcgcgctcgacgccgccctcgacgtctgggacggcgtggaccgcggc
gtgctgcgggagaagggcctcgcgctcggcgacttcttcttccggtgcgcggacgagctc
ctcggcggcgcgaagatcccgaccccgcgcggccgggaccgcgggcatcagatctcggtg
atcgacgacgacgcggccgagacgatggcggccttgatcgaccgtggggtgatcggcgac
ttccgcccgcccaacgtgctgaggttcgggctcgcgccgctctacaccacgtacggcgag
gtgctccgcgccgtcacgacgctgcgggatctccggggctga

DBGET integrated database retrieval system