KEGG   Acidovorax sp. JS42: Ajs_0390Help
Entry
Ajs_0390          CDS       T00455                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ajs  Acidovorax sp. JS42
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ajs00001]
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ajs_0390
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Ajs_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
403503..405101
Genome map
AA seq 532 aa AA seqDB search
MTSDTSTPLATVRADLLARLAQPVTYDLAVVGGGATGLGVALDAAARGFSVVLLESHDFA
KGTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLRNAPHLAQPLAFVMPSYKVWETP
FYGVGLKMYDALAGKAGLGPTEFLGRMETLRCLPTAMADGLKGGVKYWDGQFDDARLALA
LARTAAQRGALLLNYCPVDDLLYDGGKVAGVVCQDAETGRRYEVRARCVVNATGVWVDAL
RQRDGDVSGQPVKPMVAPSQGVHIVVDREFLPSDHALMVPKTADGRVLFAVPWLGKVILG
TTDSPRQDLAREPQAMREEVAFILGESARYLRRAPQASDVRSIWVGLRPLVKPSDEDAAA
TKSISREHTVLASRSGLVTVTGGKWTTYRAMAEDVLLKCMDEHLLPRRPGGITVALPLVG
AGATRERQGMNAPQGLHSYGDEAARVQALPGSQVQLAEGLSEAMVRFAARHEYARTVEDV
LARRSRVLFLDARLAAALAPRVADILREEIPGQDPQLPAFLELAAHYATVPA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactagcgacacctccacccctttggcaaccgtacgggccgacctgctggcccgcctg
gctcaacccgtgacctacgacctggcggtcgtcggaggtggggcgacgggccttggggtg
gcgctggatgcggcggcgcgcggcttttccgtcgtgctgctggaatcgcacgacttcgcc
aagggcacctcctcgcgtgccaccaagctggtgcacggcggcgtgcgctacctcgctcag
ggcaacatcgccctggtgcgcgaggcgctgcatgagcgcaccacgctgttgcgcaacgcc
ccccatctggcgcagccgttggcattcgtcatgccttcttacaaggtgtgggaaacaccg
ttctacggtgtgggcctgaagatgtacgacgccctggccggcaaggcgggcctggggcct
accgaattccttgggcgcatggagaccctgcgctgcctgcccacggccatggccgacggg
ctcaagggcggcgtgaagtattgggacgggcagttcgacgacgccagactggccctggcc
ctggcgcgtaccgccgcgcagcggggggccctgctgctcaactactgccccgtggacgac
ctgttgtacgacggggggaaggtggcgggcgtggtttgccaggatgccgagaccgggcgg
cgctacgaggtgcgtgcgcgctgcgtggtcaacgccaccggcgtgtgggtggatgccctg
cgccagcgcgatggcgatgtgagcggccagcccgtcaagcccatggtggcgcccagccag
ggggtgcacatcgtggtggaccgcgagttcttgccctccgaccatgcgctgatggtgccc
aagacggccgacgggcgggtgctgtttgcggtgccctggctgggcaaggtgattttgggc
acgaccgacagcccacgccaggatctggcgcgcgagccccaggccatgcgggaggaagtg
gccttcatcctgggggaatcggcgcgctacctgcggcgcgccccccaggcgagcgatgtg
cgcagcatctgggtgggcctgcgtcccttggtcaagccctcggacgaagacgccgccgcc
accaagagcatcagccgggaacacactgtgttggccagccgcagcgggctggtcaccgtg
actggcggcaagtggaccacctaccgcgccatggccgaggatgtactgctcaagtgcatg
gacgaacacctgctgccgcgccgcccgggcgggatcaccgttgcgctgcccctggtagga
gccggtgccacccgggagcgacagggaatgaacgcgccccagggtctgcattcctacggt
gacgaggccgcgcgggtgcaagcccttccgggttcgcaggtgcaactggccgaagggctc
agcgaggccatggtgcgctttgccgcgcgccatgagtacgcacgcaccgtggaggacgtg
ctcgcacggcgctcgcgcgtgctgtttctcgatgcgcgcctggcggccgcgctggcgccg
cgcgtggcggacatcctgcgcgaggaaatccccggccaggacccgcagctgcccgcgttc
ctagagttggccgcacactacgccacggtgccggcataa

DBGET integrated database retrieval system