KEGG   Acidovorax sp. JS42: Ajs_1890Help
Entry
Ajs_1890          CDS       T00455                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00010  Glycolysis / Gluconeogenesis
ajs00620  Pyruvate metabolism
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_1890
   00620 Pyruvate metabolism
    Ajs_1890
Enzymes [BR:ajs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Ajs_1890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ABM42070
UniProt: A1W745
LinkDB All DBs
Position
complement(1975352..1976875)
Genome map
AA seq 507 aa AA seqDB search
MNMAEIASLGIANPYKQQYGNYIGGQWVAPVDGQYFENISPINGQKFTAVPRSNSKDIDA
ALDAAHKAKAAWGRTSTTERANILNRIADRMEANLLQIAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGGISEIDADTIAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLMEIIGDLLPPGVVNVVNGFGLEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFEDVMSADDGFFDKALEGFAMFALNQGEV
CTCPSRALIQESIYERFMERALKRVAAIQQGHPLDKNTMIGAQASQEQLEKILSYLDLGK
QEGAQCLIGGARNTALGGDLAGGYYVQPTVFKGHNKMRIFQEEIFGPVVSVTTFKTEEEA
LEIANDTLYGLGAGVWSRDGARAFRMGKGIQAGRVWTNCYHHYPAHAAFGGYKQSGIGRE
NHKMMLDHYQQTKNLLVSYTQQPLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggccgaaatcgccagccttggcatcgccaacccctacaagcagcagtacggc
aactacatcggcgggcagtgggtggcgcccgtggacgggcagtacttcgagaacatctcg
cccatcaacggccagaagttcacggccgtgccgcgctccaacagcaaggacatcgacgcc
gcactggacgccgcgcacaaagccaaggccgcgtggggccgcacctcgaccaccgagcgc
gccaacatcctgaaccgcatcgccgaccgcatggaagccaacctgctgcagatcgccgtg
gccgagaccatcgacaacggcaagccgctgcgcgagaccatggcagccgacattccgctg
gccatcgaccacttccgctacttcgccggcgccgtgcgcgcgcaggaaggcggcatcagc
gagatcgacgccgacaccatcgcctaccacttccatgagccactgggcgtggtcgggcag
atcattccgtggaacttccccatcctgatggcggtgtggaagctcgcccccgcgctggct
gcgggcaactgcgtggtgctgaaacccgcggagcagacgcccgcctccatcctggtgctg
atggagatcattggcgacctgctgccgccgggcgtggtcaatgtggtcaacggctttggc
ctggaggccggcaagccgctggcctccagcaaccgcatcgcaaaaatagccttcacgggc
gagaccaccacgggccggctgatcatgcagtacgccagccagaacatcattcccgtgacg
ctggagctgggcggcaagagccccaacatcttcttcgaggacgtgatgtccgccgacgac
ggcttcttcgacaaggcgctggaaggctttgcgatgttcgcgctgaaccagggcgaggtc
tgcacctgccccagccgcgcgttgatccaggaatcgatctacgagcgcttcatggagcgc
gcgctcaagcgcgtggccgccatccagcagggccacccgctggacaagaacaccatgatc
ggcgcccaggcctcgcaggagcaactggaaaagatcctttcttacctggacctgggcaag
caggaaggcgcccagtgcctcatcggcggcgcgcgcaacaccgccctgggcggcgacctg
gccggcggctactacgtgcagcccacggtgttcaagggccacaacaagatgcgcatcttc
caggaggaaatcttcggccccgtggtctcggtgaccaccttcaagaccgaagaagaggcg
ctggagatcgccaacgacacgctctacggcctgggcgcgggcgtgtggagccgtgatggc
gcgcgcgccttccgcatgggcaagggcatccaggccgggcgcgtgtggaccaactgctac
caccactaccccgcgcacgccgcgtttggcggctacaagcagtcgggcatcggccgtgag
aaccacaagatgatgctggaccactaccagcagaccaagaacctgctggtgagctacacc
cagcagccgctgggcttcttctaa

DBGET integrated database retrieval system