Acidovorax sp. JS42: Ajs_3585 Help Entry Ajs_3585          CDS       T00455                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism ajs  Acidovorax sp. JS42 Brite KEGG Orthology (KO) [BR:ajs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ajs03000]     Ajs_3585    03036 Chromosome and associated proteins [BR:ajs03036]     Ajs_3585    03400 DNA repair and recombination proteins [BR:ajs03400]     Ajs_3585 Transcription factors [BR:ajs03000]  Prokaryotic type   Helix-turn-helix    Other families     Ajs_3585 Chromosome and associated proteins [BR:ajs03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Ajs_3585 DNA repair and recombination proteins [BR:ajs03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       Ajs_3585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HTH_8 HTH_30 Xre-like-HTH Motif Other DBs NCBI-ProteinID:  ABM43697 UniProt:  A0A9J9FXV0 LinkDB All DBs Position complement(3783045..3783278) Genome browser AA seq 77 aa AA seqDB search MSRNNIEQCVRESLQGYFRDLGGETPDGVYDMVVRLVEKPLLEVVMSHADNNQSRAAEWL GLNRNTLRKKLVEHKLL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagccggaacaacattgaacaatgcgtgcgcgagagcctgcagggctactttcgcgac ctgggcggcgagacgcccgacggcgtgtacgacatggtcgtgcgcctggtggaaaagccg ctgctggaggtggtgatgagccacgccgacaacaaccagtcccgcgccgccgaatggctg gggctgaaccgcaacacgctgcgcaagaagctggtggagcacaagctgctttga

DBGET integrated database retrieval system