KEGG   Acinonyx jubatus (cheetah): 106969353Help
Entry
106969353         CDS       T04657                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju05034  Alcoholism
aju05165  Human papillomavirus infection
aju05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aju00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    106969353 (HDAC7)
  Substance dependence
   05034 Alcoholism
    106969353 (HDAC7)
  Infectious diseases
   05165 Human papillomavirus infection
    106969353 (HDAC7)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106969353 (HDAC7)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106969353 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 106969353
NCBI-ProteinID: XP_014921348
LinkDB All DBs
Position
Un
AA seq 922 aa AA seqDB search
MILPCVNRAVRSCTLCMQGCVRSDGTQVSPGAHCPSPPGTGRLRPPARAPGAVASSVVKQ
KLAEVILKKQQAALERTVHPNSPSIPYRTLEPLETEGAARSMLSSFLPPVPSLPSDPPEH
FPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPAS
GCSSPNDSEQGPNPVLGSEALLGQRLRLQETSXPFALPTVSLLPAITLGLPAPARADADR
RTHPTLGPRGPVLGSPHAPLFLPHSLESESGGPLSSRLQPILLLDPSVSHAPLLTVPGLG
PLPFHFAXXXXXXXXXSGLHRPLSRTRSEPLPPSATAPPPLGPLQPRLDRLKPHVQLIKA
SPAKGEKPRLRQIPSAEDLETDGGGVGPLGDDGLEHRESSHGQHEARGPIPLQQHQQVFL
WEQQRLAGRLPRGGTGDSVLLSLAQGSHRPLSRAQSSPAAPASLPTPEPASQARVLPSSE
TSARTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRSQCECLRGR
KASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWN
ELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACR
QLQQQGKAGKILIMDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAG
SGEGFNVNVAWAGGLDPPMGDPEYLAAFRMVVMPIAREFSPDLVLVSAGFDAAEGHPAPL
GGYHVSAQCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDPLSEE
GWKQKPNLNAIRSLEAVIQVHSKYWGCMQRLASCPDSWVPRVPGADTEEVEAVTALASLS
VGILAEERPSQQLVEEEEPMNL
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgattctgccctgtgtaaacagggctgtgcgctcgtgtaccctgtgtatgcaaggctgc
gtgcgctcagatgggacccaggtgagcccgggtgcccactgccccagtccccctggcaca
ggccgcctcaggcccccagcgagggcccctggtgccgtagctagcagtgtggtcaagcag
aagctggcagaggtgattctaaagaagcagcaggcagccctagagagaacagtccatccc
aatagccccagcattccctacagaactctcgagcccttggagacggaaggagctgctcgc
tctatgcttagcagctttctgcctcctgttcccagcctgcccagtgaccccccagaacac
ttccctctccgaaagacagtctctgagcccaacctgaagctgcgctacaagcccaagaag
tccctggagaggaggaagaatccactgctcagaaaggagagcgccccgcctagtctccgg
cggcggcctgcagagaccctcggtgactcctcccccagtagcagcagcacaccagcatca
gggtgcagctcccccaatgacagcgagcaaggccccaaccccgtcctgggctcggaggcg
ctcttgggccagcggctgcggctgcaggagacctctnccccgttcgccttgccgacagtg
tccttgctgcccgcaatcacgctggggctccccgcccctgccagggctgatgctgaccgc
aggacccatccgacactgggccctcgggggccggtcctggggagcccccatgctcccctc
ttcctgccccacagcctggagtctgagtctgggggccccttgtcctctcgactacagccc
attctcctcctcgatccctcagtctctcacgcgcccctgctgactgtgcccgggcttggg
cccctgcccttccactttgcccnnnnnnnnnnnnnnnnnnnnnnnnngtcaggcctccac
cggccactaagccggacccgctcagagcccctgcccccaagcgccaccgcccccccaccg
ctgggccccctgcagccccgcctggaccggctcaaacctcacgtccagctgatcaaggcc
agcccagccaagggtgagaagccccgactgcggcagatcccctcagctgaggacctggag
acagatggtgggggagtggggccgctgggggatgacggcctggagcacagggagtcaagc
catgggcagcacgaagccagaggccctattcctctccagcagcaccagcaggtgttcctc
tgggagcagcagcgactggctgggcggctcccacggggaggaactggggactctgtgctg
ctttccctggcccagggcagtcaccggcccctgtccagggctcagtcatccccagctgcg
cctgcctcactgccaaccccagagcctgccagccaggcccgtgtcctgcccagctcagag
acctctgccaggaccctgccgttcaccacagggctggtgtatgactcggtgatgctgaaa
caccagtgctcctgcggggacaacagcaggcacccggagcacgcgggccgtatccagagc
atctggtcccggctgcaggagcgggggctccggagccagtgtgagtgtctccggggccgg
aaggcctccctggaggagctgcagtcagtgcactccgagcggcacgtgctcctctatggc
accaacccgctcagccgcctcaaactggacaacgggaagctggcagggctcctggcacag
cggatgtttgtgatgctgccctgtggtggggtaggggtggataccgataccatctggaat
gagctgcattcttccaatgcggcccgctgggcagccggcagtgtcactgaccttgccttc
aaagtcgcttcccgtgagctaaagaatggttttgctgtggttcggcccccaggacaccat
gcggaccattccacagccatgggcttctgcttcttcaactccgtggccattgcctgccgg
cagcttcaacaacagggcaaggccggcaagatcctcatcatggactgggatgttcaccat
ggcaatggcacccagcaaaccttctaccaggaccccagtgtgctctacatctccctgcat
cgccatgatgatggcaacttcttccccggcagtggggccgtggatgaggtgggagctggc
agcggtgagggcttcaatgtcaacgtggcctgggcaggaggtctagacccccctatgggg
gatcctgagtacctggctgccttcaggatggttgtgatgcccattgcccgagagttctct
ccggacctggttctggtgtcagctgggtttgatgctgccgagggtcacccagccccgctg
ggtggctaccatgtttccgctcaatgttttgggtacatgacccagcagctgatgagcttg
gcgggaggtgcagtggtgctggccttggaaggtggccatgacctcacagccatctgtgac
gcttctgaggcctgtgtggctgctcttctgggaaacaaggtggatcctctctcagaagaa
ggctggaagcagaaacccaacctcaacgccatccgctctttggaagccgtgatccaggtg
cacagtaaatactggggctgcatgcagcgcctggcctcctgtccagactcctgggtgccc
agggtgccaggggccgacacagaagaagtggaggcagtgaccgcactggcatccctctcc
gtgggcatcctggctgaagagcggccctcacaacagctggtggaggaggaagaacctatg
aatctctaa

DBGET integrated database retrieval system