KEGG   Acinonyx jubatus (cheetah): 106975897Help
Entry
106975897         CDS       T04657                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00511  Other glycan degradation
aju00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aju00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    106975897 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    106975897 (NEU2)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     106975897 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR
Motif
Other DBs
NCBI-GeneID: 106975897
NCBI-ProteinID: XP_014928764
LinkDB All DBs
Position
Un
AA seq 400 aa AA seqDB search
MESCPILQKERVFQSGAHAYRIPALLYLPEQKTVLAFAEQRISKKDEHAELIVLRRGSYD
ASTHQVQWHAQEVVAQAQLEGHRSMNPSPLYDEETGTLFLFFIAIPGQVSEHHQLHTRVN
VTRLCQVTSPDHGRSWSPARDLTGPAIGTAHKEWATFAVGPGHCLQLRNKTRSLVVPAYA
YRNLHPHRRPSPFAFCFVSHDHGHTWQRGNFVAQDTVECQVAEVGGAEQRVVYLNARSPL
RARVQAESTNEGLDFKEAQLVEELVEPPXRXXXXXPAPGAGTDASDRWLLYTHPTDPRQR
AHLGAYLSKPRPGPAAWSEPALLATGSCAYSDLQSMGTGPDGSPQFGCLYESDDYEAVIF
VTFTLKQAFPAEFLSLGASCVPSRKDSRRPGAPLPPEHPE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtgccccatcctgcagaaggagagagtgttccagtcaggagcccatgcctac
aggatccccgctctgctgtatctgcctgagcagaagacagtgttggccttcgcggaacag
cggataagcaagaaggatgagcacgcagagctgatcgtcctgcgcagaggaagctatgac
gcatccacccatcaggtccagtggcacgctcaggaggtggtggcccaggcccagctggag
ggccaccggtccatgaacccaagccccttgtacgacgaggagacaggaaccctcttcctc
ttcttcatcgccatcccggggcaggtgtccgagcaccaccagctccacaccagggtcaac
gtgactcggctgtgccaggtcaccagccccgaccacgggaggtcctggagccccgcccga
gacctcactggccccgccatcggcacagcccacaaggagtgggccacttttgcggtgggt
ccggggcactgcctgcagctgcgcaacaagacgcggagtctggtggtgcccgcctacgct
taccggaaccttcacccccaccggcggccttcgccctttgccttctgcttcgtcagccat
gaccacgggcacacgtggcagagagggaacttcgtggcccaggacaccgtggagtgtcag
gtggccgaagtcgggggtgcagagcagagggtcgtgtatctgaacgcgaggagccccctc
agagccagggtccaggccgagagcaccaacgagggcctcgacttcaaggaggcccagcta
gtggaggagctcgtggagcctccgncacgnnnnnnnnnnnnnntccccgcccccggtgcg
gggacggacgcctcggacagatggctgctctacactcaccccaccgacccacggcagaga
gcccacctgggcgcgtacctcagcaagccgcgcccgggccccgcggcctggtcggagccc
gccctgctggccacgggcagctgcgcttactcagacctccagagcatgggcaccggccct
gacgggtcaccgcagttcgggtgtctgtacgaatcggacgattacgaggcggtcatcttc
gtcacgttcaccctgaaacaagccttcccagctgagtttttgtctttgggagccagctgt
gtgccatccaggaaggactcccgccggcctggggccccccttcctcctgaacaccccgag
tga

DBGET integrated database retrieval system