KEGG   Acinonyx jubatus (cheetah): 106978956Help
Entry
106978956         CDS       T04657                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETMAR
  KO
K11433  histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aju00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106978956
Enzymes [BR:aju01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106978956
Chromosome [BR:aju03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106978956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 106978956
NCBI-ProteinID: XP_014932198
LinkDB All DBs
Position
Un
AA seq 300 aa AA seqDB search
MATPKEGPERPTERLDIARGLENVPVSAWPPGAEPEPFQYTPDHVAGPGTDIDPTQITFP
GCICLKTCLPGTCSCLRHAENYDDNSCLIDTGSQGKCANPVFECNILCQCSDQCKNRVVQ
QGLQFQLQVFKTDKKGWGLRTLEFIPKGRFVCEYAGEVLGYSEVQRRIQLQTIQDPNYII
AVREHVYSGQVIETFVDPASIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDILP
EEELSYDYSGRFLNLMDSKDKERLDQGKTRKPCYCGARSCAAFLPYDSSLYCPLGKSNIS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcctaaggaggggcctgagagaccgacggagcgcctggatattgcgcgcggc
ctggagaacgtgcccgtgagcgcgtggcccccgggggcggagccagagcctttccagtat
actcctgaccacgtagctggacctggaacagacatcgatcccacacaaataacctttccc
ggatgcatttgtctcaaaacctgcctccctggtacttgctcctgtctccgtcatgcagag
aactatgatgataattcctgccttatagatacaggatcccaaggcaagtgtgccaacccg
gtttttgaatgcaatatcctgtgccagtgcagtgaccagtgcaagaacagagtggtccag
caaggtctacagttccaactccaggtgttcaagacggataaaaaaggctggggacttcgt
accttggaatttataccaaaaggacggtttgtctgtgaatatgccggagaagttttggga
tactctgaagtacagagaagaattcagttacaaacaatacaggacccaaattacattata
gccgtcagagaacatgtttacagtgggcaggtaatagaaacatttgttgatcctgcctct
ataggaaatattggaagatttcttaaccattcttgtgagccaaacctgttgatgattcct
gtccgaattgactcaatggtacccaagttggcactttttgcagccaaagacattttgcca
gaagaagaactctcttatgactattcgggaagatttcttaatttaatggacagcaaagac
aaagaaaggctagatcaagggaaaacaagaaaaccttgttattgtggtgccagatcgtgt
gctgctttcctcccttatgacagttcactatactgccccttaggaaagtcaaacataagt
tag

DBGET integrated database retrieval system