KEGG   Acinonyx jubatus (cheetah): 106987870Help
Entry
106987870         CDS       T04657                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
aju  Acinonyx jubatus (cheetah)
Brite
Enzymes [BR:aju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     106987870 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 822 aa AA seqDB search
MMDGPRSDVGRWGGNPWQPPTTPSPEPEPEPEPERRSRRGGRSFWARCCGCCSCRNETDA
DWGPEPHGDRGSGRGRGSSSGGRRPDSRGSDSRRPGSRASGVNAAGDGTIREGMLVVTGV
DLLSSRSDQNRREHHTDEFEYDELILRRGQPFDMVLHLSRPYESSDHVALELLIGNSPEV
GKGTHVIIPVGKGGSGGWKAQVTKASGQNLDLRVHTSPNAIIGKFQFTVRTRSEAGEFLL
PFDPHNEIYILFNPWCPEDIVYVEHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDH
GVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAW
VGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDI
YFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFGGWQVVDATPQETSSGIFCCGPC
SVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIITKAIGSN
MRDDVTHIYKHPEGSEAERKAVETAAAHGSKPNVYSTRDSAEDVAMQVEAQDAVMGQDLT
VCVVLTNRSSSRRTVKLHLYLSVTFYTGVTGSVFKESKKEVVLAPGASDRVSMPVAYKEY
RPHLVDQGSMLLNVSGHVKENGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKN
PLPITLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLHQKFVPVRPGPRQLIASLDSPQL
SQVHGVIQVDVAPAPGSGGFFSDAGGDSHSGETIPMASRGGA
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgatggacggtcctcgttcagatgtgggccgctggggcgggaacccttggcagcccccc
accacaccttccccagagccagagccggagccggagccggagagacgatctcgtcgagga
ggccgttccttctgggctcgctgctgcggctgctgctcatgccgaaatgaaacagatgct
gactggggacctgagccccatggagaccgagggtctggcaggggtcgagggtccagctct
gggggtcgaagaccagactcccggggctcagattcccgccggcctggctcccgggccagt
ggtgtgaacgcagctggagacggcaccatcagagagggcatgctggtggtgaccggtgtg
gatctgctgagttcacgctcggaccagaatcgccgagagcaccacacagatgagtttgag
tacgacgagctgattttacgccgtgggcagcctttcgacatggtcctccacctctctcgg
ccctatgagtcctctgatcatgttgccctggagctgcttatcggaaacagccccgaggtg
gggaagggcacgcacgtgatcatcccagtggggaaggggggcagcggaggctggaaagcc
caggtgaccaaggccagtgggcagaatctggacctacgtgtccacacctcccccaacgcc
atcatcggcaagtttcaattcacggtccgcacacgttcagaggctggcgagttcctgttg
ccttttgacccccacaacgagatctacatcctcttcaatccatggtgtccagaggacatc
gtgtacgtggagcatgaggattggcgacaggagtacgtgcttaatgaatccgggagaatt
tactatgggactgaagcacagattggcgagcggacctggaactatgggcagtttgaccat
ggagtgctggatgcctgcctgtacatcctagacaggcggggcatgccatatggaggccgc
ggggacccggtcagtgtctcccgggtcatctctgccatggtgaactccttggatgacaat
ggggtcctgattggaaactggtctggtgattactcccgaggcaccaacccatcagcttgg
gtgggcagtgtggagatcctactcagctacctacgcaccggctattccgtcccctatggc
cagtgctgggtcttcgccggtgtgaccacaacagtgctgcgttgcttgggcctggctacc
cgcactgtcaccaatttcaactcggcacatgacacagacacatccctcaccatggacatc
tactttgacgagaatatgaagcctctcgagcacctgaaccatgattctgtttggaacttc
cacgtgtggaacgactgctggatgaagaggccagatctgccctctggctttggtgggtgg
caggtggtggatgccacaccccaggaaaccagcagcggcatcttctgctgcggcccctgc
tctgtggagtccatcaagaatggcctggtatacatgaaatacgacacgcccttcattttt
gctgaggtcaacagtgacaaagtttactggcagcgacaggatgatggtagctttaagatc
gtgtatgtggaagagaaggccattggtacgctcatcataacaaaggccattggatccaac
atgcgagatgatgtcacccacatttataaacacccagaaggctcagaagcagagcggaag
gcagtggagacagcagccgcccacggcagcaaacccaacgtgtactccacgcgtgactca
gcagaggatgtggcgatgcaggtggaggcacaggacgcggtgatggggcaggacctgacc
gtctgcgtggtgctgaccaatcgcagcagcagccgccgcaccgtgaagctgcacctctac
ctctcggtcaccttctacaccggtgtcaccgggtctgtcttcaaggagagcaagaaagaa
gtggtgctggcgccaggggcctcggaccgcgtgtccatgcctgtggcctacaaggaatac
cggccccacctggtagatcaggggtccatgctgctcaacgtctcgggccacgtcaaggag
aacgggcaggtgctggccaagcagcacaccttccgtctgcgcacccctgacctttccctc
accttgttgggggcagccgtggttggtcaggagtgcgaagtacagattgtcttcaagaac
ccgctgcctataaccctcaccaatgtcgtcttccggcttgagggctccgggctacagaga
cccaagatcctcaatgtgggggacattgggggcaacgagacagtgacgctgcaccagaag
tttgtgcctgtgcgaccaggcccccgccagctcatcgccagcttggacagcccccagctc
tcccaggtgcatggtgttatccaggtggacgtggctccggcccctgggagcggaggcttc
ttctcagatgctggaggcgacagtcactcaggggagaccatccctatggcatctcgaggt
ggagcttaa

DBGET integrated database retrieval system