KEGG   Azospirillum lipoferum: AZOLI_p50101Help
Entry
AZOLI_p50101      CDS       T01658                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ali  Azospirillum lipoferum
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZOLI_p50101 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZOLI_p50101 (ppc)
   00680 Methane metabolism
    AZOLI_p50101 (ppc)
Enzymes [BR:ali01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AZOLI_p50101 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
AZO_p5:complement(95248..98019)
Genome map
AA seq 923 aa AA seqDB search
MSAILLQESSETKDQPLREDIRLLGRILGDTVRSQEGEAVFDIVERIRQTSIRFHREEDQ
GARKELEAILNSLSPPQTARVVRAYSFFSHLANIAEDQHHIRRTRAHALAGSSPRDGTMA
HALDEATKAGITTQQLKEFFDSALVSPVLTAHPTEVQRKSILTVQMAVAKLLAERDHGPM
TPEEEETNLESLQRAVLTLWQTAILRATKLAVTDEVANGLTFYDYTFLREMPRFYAQLED
HLRRMDPSWATTELPSFLRMGSWIGGDRDGNPFVTAPVLRQAMRMQSTRALQFYLDELHT
LGSELSLSTRVIDVSEPLRQLAERSPDPSPHRKLEPYRRAISGIYARVAATLRTLDGLEA
PRHAVGDAPPYLTPAELRADLDIIDRSLTVNGSAALAKGRLRHLRRAVDLFGFHLASIDL
RQNSDVHERSVAELLSFADAGVDYTSLSEDERIELLVRELETNRPLASGYADYSEETSSE
LDILRTAADARTRFGSDAVVNCVISKTDGVSDILEVAVLLKEAGLLRPKDKALDLNIAPL
FETIGDLRNCAATMDRLLSIPTYRRFLESRGNLQEVMLGYSDSNKDGGFLTSGWELYKAE
IALVEVFAKHGVRLRLFHGRGGSVGRGGGPSYQAILAQPAGAVQGAIRITEQGEVIAGKY
SNPEVGRRNLETLAAATLEATLLHPESAEPCTDVFLQTMEELSEHAFKAYRGLVYETEGF
EKYFWESTVIGEIANLNIGSRPASRKKSTSIEDLRAIPWVFSWAQCRLMLPGWYGFGSAV
KAYLAEHPDGMERLRAMHRDWGFFRTLLSNMDMVLSKSNIAIASRYAGLVSDPELRDAIF
SRIRAEWQDCIEVLLAITEQSALLEKNPLLARSIRNRFPYLDPLNHVQVELLKRHRTSDS
GEQIARGIHLTINGIAAGLRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatcctgctgcaggaaagttccgagacgaaggaccagccgctccgcgaagac
atccgcctgctggggcgcatcctgggcgacaccgtccgcagccaggaaggggaggcggtg
ttcgacatcgtcgagcgcatccgccagacctccatccggttccaccgtgaagaggaccag
ggcgcccgcaaggagctggaggcgatcctgaacagcctgtcgccgccgcagacggcgcgg
gtggtgcgggcctacagcttcttctcgcacctcgccaacatcgccgaggaccagcaccac
atccgccgcacccgcgcccatgcgctcgccgggtcgtcgccgcgcgacggcaccatggcc
catgcgctggacgaagcgacgaaggccggcatcaccacccagcagctgaaggagttcttc
gacagcgcgctggtcagcccggtgctgaccgcccacccgaccgaggtgcagcgcaagagc
atcctgaccgtgcagatggcggtcgccaagctgctggcggagcgcgaccacggcccgatg
acgccggaggaggaggaaaccaacctcgaatcgctccagcgcgccgtgctgaccttgtgg
cagaccgcgatcctgcgcgccaccaagctggcggtgacggacgaggtggcgaacggcctg
accttctacgactacaccttcctgcgcgagatgccgcgcttctacgcccagctggaggac
catctgcggcggatggatccgtcctgggcgacgacggaactgccgtccttcctgcgcatg
ggcagctggatcggcggcgaccgcgacggcaaccccttcgtcaccgcccccgtgctgcgt
caggcgatgcggatgcagagcacccgcgccctgcaattctatctggacgaactgcacacg
ctggggtcggagctgtcgctcagcacccgcgtcatcgacgtgtcggagccgctgcgccag
ctggccgaacgctcccccgacccgtcgccgcaccgcaagctggagccgtaccgccgcgcc
atttccggcatctatgcgcgggtcgccgcgacgttacggacgctggacgggctggaggcg
ccgcgccatgccgtcggcgacgcgccgccctacctgaccccggccgagcttcgcgccgac
ctggacatcatcgaccgctcgctgaccgtcaacggctcggccgcgctcgccaagggccgg
ctgcgccacctgcgccgggccgtcgacctgttcggcttccatctggccagcatcgacctg
cgccagaactccgacgtgcatgagcggtcggtggccgaactgctgtccttcgccgacgcc
ggggtcgactacacgtcgctgtcggaggacgagcggatcgagctgctggtgcgcgagttg
gagaccaaccggccgctcgcctccggctacgccgactattcggaggaaaccagctccgaa
ctggacatcctgcgcaccgccgccgatgcccgcacccgcttcgggtcggatgcggtggtg
aactgcgtcatctccaagaccgacggcgtgtcggacatcctggaggtcgccgtcctgctg
aaggaagccgggctgctgcggccgaaggacaaggcgctggacctgaacatcgccccgctg
ttcgagaccatcggtgacctgcgcaactgcgccgccaccatggaccggctgctgtcgatc
ccgacataccggcgcttcctggaaagccgcggcaacctgcaggaggtgatgctcggctat
tcggacagcaacaaggacggcggattcctcacctccggctgggagctgtacaaagccgag
atcgcgctggtcgaggtgttcgccaagcatggcgtgcggcttcgcctgttccacggccgc
ggcggctcggtcggccgcggcggtggtcccagctatcaggcgatcctggcccagccggcc
ggcgcggtgcagggcgccatccgcatcaccgagcagggcgaggtcatcgccgggaagtat
tccaaccccgaggtcggccgccgcaacctggaaacgctggcggcggcgacgctggaagcg
accctgctgcacccggaatcggcggagccctgcaccgatgtgttcctccagaccatggaa
gagctgtcggagcatgccttcaaggcctatcgcgggctggtctacgagaccgagggtttc
gagaagtatttctgggaatcgacggtgatcggcgagatcgccaacctcaacatcggcagc
cgtccggcctcgcgcaagaagtcgaccagcatcgaggatctgcgcgccattccctgggtg
ttcagctgggcgcaatgccgcctgatgctgccgggctggtacggtttcggctcggcggtg
aaggcctatctggccgagcatccggacgggatggagcggctgcgcgccatgcatcgcgac
tggggcttcttccgcacgctgctgtccaacatggacatggtgctgtccaagtcgaacatc
gccatcgcgtcccgctatgccgggctggtgtccgacccggagcttcgcgacgccatcttc
tcccgcatccgggcggagtggcaggactgcatcgaggttctgctggcgatcaccgagcag
tcggccctgctggaaaagaacccgctgctggcgcggtcgatccgcaaccgcttcccctat
ctggacccgctcaaccacgtccaggtcgagttgctgaagcgtcaccgcacaagcgacagc
ggggaacagatcgcccgcggcatccatctgaccatcaacggcatcgccgccggattgcgc
aacagcggctga

DBGET integrated database retrieval system