KEGG   Alloactinosynnema sp. L-07: CRK55933Help
Entry
CRK55933          CDS       T04489                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
all  Alloactinosynnema sp. L-07
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:all00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CRK55933
   00650 Butanoate metabolism
    CRK55933
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CRK55933
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CRK55933
Enzymes [BR:all01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CRK55933
Amino acid related enzymes [BR:all01007]
 Aminotransferase (transaminase)
  Class III
   CRK55933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:918344..919702
Genome map
AA seq 452 aa AA seqDB search
MVSTLSTDHTRGMADTQQTPLIDRHRAVLPSWLALYYADPIELVSAEGRHVTDADGKTYL
DFFAGILTNAIGYDIAEISDAIRRQLDSGVLHTSTLYLIRGQVELAEKIAKLSGIPDAKV
FFTNSGTEANETALMLSTQFRRSNQVLALRNSYHGRAFGTVGITGNRGWSASSLSPVKVS
YVHGGYRYRSPFGHLSDADYIQACADDLREVLNTTTSGDVACMIAEPIQGVGGFCVPPDG
LYKAFKEILDESGILLVSDEVQTGWGRTGEHFWGIQAHGVTPDMMTFAKGLGNGLAIGGL
VARPDVMDCLTANSISTFGGNPIATAGANAVIDYLLDNDLQANAEKQGIRLSEGLHDIAH
RHPVVGDVRGKGLMIGVELVEPGGKAPNPTAAVRVLEETKARGLLVGKGGLHNNVIRLAP
PMTLTEHEVDEALDVLSEAIAVADAAAQGGEG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgacgctgtccaccgaccacactcgcggcatggccgacacccagcagacgccg
ctgatcgaccgtcaccgagcggtcctaccgtcctggctcgcgctctactacgccgacccg
atcgagctggtgagtgccgagggcaggcatgtcaccgacgccgacgggaagacctatctc
gacttcttcgccggaatcctgaccaacgccatcggctacgacatcgccgagatcagcgac
gcgatccggcgtcagctcgactcgggggtcctgcacacctcgacgctctacctcatccgc
ggccaggtggagttggccgagaagatcgccaagctgtccggcatcccggacgcgaaggtg
ttcttcaccaactccggcaccgaggccaacgagaccgcgctcatgctgtcgacccagttc
cgtcgcagcaaccaggtcctcgcgctgcgcaactcctaccacgggcgcgcgttcggcacg
gtcggcatcaccggcaaccggggctggtcggccagcagcctgtcgccggtcaaggtcagc
tacgtccacggcggctaccgctaccgcagccccttcggccacctcagcgacgccgactac
atccaggcctgcgccgacgacctgcgcgaggtcctcaacaccacgacctccggcgacgtc
gcgtgcatgatcgccgagccgatccagggggtcggcgggttctgcgtgccaccggacggg
ctctacaaggcgttcaaggagatcctggacgagagcgggatcctgctggtctccgacgag
gtgcagaccgggtggggccgcacgggcgagcacttctggggcatccaggcccacggcgtc
acgccggacatgatgactttcgccaaggggctgggcaacggcctggccatcggcgggctg
gtcgcgcggccggacgtcatggactgcctgaccgccaactcgatctccaccttcggcggc
aacccgatcgccacggcaggcgcgaacgccgtgatcgactacctgctggacaacgacctg
caggccaacgccgagaagcagggaatccggctgtccgagggactgcacgacatcgcccac
cggcacccggtggtcggcgacgtgcgcggcaagggcctgatgatcggcgtcgagctggtc
gagcccggcggtaaggcccccaacccgacggccgcggtgcgcgtgctggaggagaccaag
gcgcgtgggctgctggtcggcaagggcggcctgcacaacaacgtcatccggctcgcgccg
ccgatgacactgaccgagcatgaagtcgacgaagcgctcgacgtcctcagcgaagcgatc
gctgtcgcggacgccgcagcgcagggtggtgagggctga

DBGET integrated database retrieval system