KEGG   Alloactinosynnema sp. L-07: CRK58937Help
Entry
CRK58937          CDS       T04489                                 

Definition
(GenBank) Glycosyltransferase
  KO
K16150  
glycogen synthase [EC:2.4.1.11]
Organism
all  Alloactinosynnema sp. L-07
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:all00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CRK58937
Enzymes [BR:all01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CRK58937
Glycosyltransferases [BR:all01003]
 Polysaccharide
  Storage polysaccharide
   CRK58937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:4149119..4150372
Genome map
AA seq 417 aa AA seqDB search
MRVLMLSWEYPPVVVGGLGRHVHAIARHLAGQGHDVVVLCRHEAGTDAETHPTEDGTHDG
VRVIRVAEDPTHLVFEKDLVAWTLAMGHAMIRAGLSLLSEWRPEVVHAHDWLVTHPAVAL
AEHARVPLVATVHATEAGRHSGWLSQPLNQQVHSVEWWLANRADALITCSSAMRAEVAHL
FEVEPDTITVIHNGIEPRSWRVPPAAVRTSRASHSPYNAPLLLFFGRLEWEKGVQDIIGA
LPRIRRTHPGTRLVVAGRGTYAPALEELARKLRVRRAIDFAGHLSDRDLGALLAAADSVV
LPSRYEPFGIVALEAAAAGAPLVASTAGGLGEVVIEGETGLSFTPGDLDGLSTAVRRVLD
DPTGARRRAKLAKARLAVDFDWDLIATQTAEVYAKADAGAHAPLGRPKIATGNAFLA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctgatgctgtcctgggagtaccccccggtcgtggtcggggggctgggcagg
cacgtgcacgcgatcgcccgccacctggcgggccagggacatgacgtggtcgtgctgtgc
aggcacgaggcgggcaccgacgccgagacccaccccaccgaggacggcacgcacgacggc
gtccgggtgatccgggtagccgaggacccgacgcacctggtgttcgagaaggatctggtc
gcctggaccctggcgatgggccacgcgatgatccgcgccggtctgtcactgctcagcgag
tggcgccccgaggtggtgcacgcccacgactggctggtgacccacccggccgtcgccctg
gccgagcacgcgcgggtcccgctggtcgcgaccgtgcatgccaccgaggcaggcagacac
agcggctggctgtcgcagccactgaaccagcaggtgcactcggtcgaatggtggctggcg
aaccgagccgacgccctgatcacctgctcgtcagcgatgcgcgccgaggtcgcccacctc
ttcgaggtcgagccggacacgatcaccgtcatccacaacggcatcgaaccgcgaagctgg
cgcgtaccgcccgccgccgtccgaacgtcccgtgcctcccacagcccgtacaacgcgcca
ctgctgctgttcttcggcaggctggagtgggagaagggcgtccaggacatcatcggcgcg
ctgccccggatccgccgcacacatcccggcacccgactggtcgtggccggccgcggcacc
tacgcgcccgcactggaagaactggcccgcaagctgcgcgtccgccgcgcgatcgacttc
gccggacacctctccgaccgcgacctaggcgccctactcgccgcagccgactcggtagtc
ctgcccagccgctacgagcccttcggcatagtcgccctggaggccgccgcggcaggcgca
cccctggtggcctcgaccgcgggcggcttgggcgaggtcgtcatcgaaggcgagaccggc
ctgtccttcacccctggcgacctggacggcctgtccaccgccgtccgccgcgtgctggac
gacccgaccggcgcccgccgccgggcgaagctggccaaggcccgcctggccgtcgacttc
gactgggacctgatcgccacccaaaccgccgaggtctacgccaaggccgacgcgggcgcc
cacgcgccgctcgggcgtccaaagatcgccacaggcaacgcgttcctcgcttag

DBGET integrated database retrieval system