KEGG   Alloactinosynnema sp. L-07: CRK59784Help
Entry
CRK59784          CDS       T04489                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
all  Alloactinosynnema sp. L-07
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:all00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CRK59784
Enzymes [BR:all01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CRK59784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(4978119..4979867)
Genome map
AA seq 582 aa AA seqDB search
MATRKPPRSTSDPIGGRLDPAVRTQAWEKLGSETFDVVIIGGGVVGTGAALDAATRGLKV
ALVEARDLASGTSSRSSKLFHGGLRYLEQLEFGLVREALRERELMLTRLAPHLVKPVSFL
YPLTKRIWERPYTAAGLFLYDTMGGSRSVPGQKHLTRAGALRMVPALRRGSLIGGIRYFD
AQADDARHTMTVGRTAAHYGAVVRTSTQVVAFLREADRVAGVRVRDVEDGRETDVRANVV
INCTGVWTDEIQRASGSRGRFRVRASKGVHIVVPRDRIVSESGLILRTEKSVLFVIPWRN
HWIVGTTDTDWNLDLAHPAATKADIDYILDHVNTVLATPLTHDDIEGVYAGLRPLLAGES
EESSKLSREHAVARVAPGLVAIAGGKYTTYRVMAADAVDAASVDLPGRLQPSITDRVPLL
GADGYHALVNQADLLAARHGLHPYRVRHLLDRYGALVHEVLDLGSERPELLKPVDAAPDY
LQVEIVYAAACEGALHIEDTLARRTRISIEYPHRGVDCAEQVAALMGSVLGWSASQVQHE
VAVYLARVEAERDSQTLPDDEAADATRSAAPEARPHLLEPVL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtggccacgcgcaagcccccacgatccacatcggacccgatcggcggcaggctggatccc
gcggtcaggacccaggcctgggagaagctcgggtcagagacgttcgacgtggtgatcatc
ggcggcggcgtcgtcggcaccggagccgccctcgacgccgccaccagggggctcaaggtc
gccctggtcgaggcgcgcgacctggcctcggggacgtcgagccggtcgagcaagctgttc
cacggcggcctgcggtacctggagcaactggagttcggcctggtccgcgaggccctgcgc
gagcgcgagttgatgctcacccggctggccccgcatctggtcaagccggtcagcttcctc
tacccgctgacgaagcggatctgggagcggccctataccgccgctggtctgttcctttac
gacacgatgggcggttcccggtcggttcccggccagaagcacctcacccgtgcgggtgcg
ttgcggatggtccccgcgctgcgccgcgggtcgctgatcggcggcatccgctacttcgac
gcccaggccgacgacgcccgccacaccatgaccgtcgggcgcaccgcggcccactacggc
gccgtcgtgcgcacgtcgacgcaggtcgtggccttcctgcgggaggccgaccgggtggcg
ggggtgcgcgtccgtgacgtggaggacggccgcgagaccgacgtcagggccaacgtggtg
atcaattgcacgggcgtgtggaccgacgagatccagcgcgcctccggcagccggggccgg
tttcgggtgcgggcgagcaagggcgtgcacatcgtcgtcccgcgcgaccggatcgtctcc
gagtccgggctgatcctgcgcacggagaagtcggtgctgttcgtgattccgtggcgcaat
cactggattgtggggacgaccgacaccgactggaatctcgatctggcccatccggcggcc
accaaggccgacatcgattacatccttgatcacgtcaacacggtgctcgcgacccctttg
acgcacgacgacatcgagggcgtctacgcggggttgcggccgttgttggcgggcgagagt
gaggagagttcaaagctgtcccgtgagcacgcggtcgcccgggtcgcgcctgggctggtc
gccatcgcgggcgggaagtacacgacctaccgggtgatggcggccgacgcggtggacgcg
gcctcggtcgacctgccggggcggttgcagccttcgatcaccgatcgggtgccgctgttg
ggggcagacgggtatcacgcgctggtgaaccaggccgacctgctggcggcgcggcatggg
ctgcatccgtatcgggtgcggcatctgctggaccggtatggggcgttggtccacgaggtg
ctcgacctgggttcggaacgcccggaactgctgaagccggtcgacgcggcgccggactat
ctgcaggtcgagatcgtgtacgcggcggcgtgtgaaggtgctttgcacatcgaggacacg
ttggctcggcggacgcggatctcgatcgagtatccgcatcgtggggtcgactgcgccgag
caggtggccgcgttgatggggtcggtgctggggtggtccgcttcgcaggttcagcacgag
gtcgcggtgtatctggccagagtcgaagcggagcgtgactcgcagaccctgccggacgac
gaggccgccgacgccacgcggtcggccgcgccggaagcgcggccgcatctgttggagccg
gttctctag

DBGET integrated database retrieval system