KEGG   Algoriphagus sp. M8-2: AO498_00860Help
Entry
AO498_00860       CDS       T04334                                 

Definition
(GenBank) alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
alm  Algoriphagus sp. M8-2
Pathway
alm00500  Starch and sucrose metabolism
alm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AO498_00860
Enzymes [BR:alm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AO498_00860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AMQ54921
UniProt: A0A142EIG6
LinkDB All DBs
Position
182573..183781
Genome map
AA seq 402 aa AA seqDB search
MRTVCFYFQVHQPFRVKPYRFFEIGEDHYYWDDFLNRNVVRKVAQKCYLPMNALLLDLIH
KYQGKFKVAFSLSGTFLDQIEAYAPDVLESFQKLVATGHVELLNETYSHSLASLKSKEEF
FGLVEKHQAKIKQLFNGYTPKVFRNTELIYSDQIGAMVSELGYEAILTEGAKHVLGWKSP
NYVYNNSINPNLKVLLKNFLLSDDIAFRFSNKTWADYPLTTDKFVSWLNAIPKEEQVVNL
FMDYETFGEHQWAETGIFEFMRHLPEAIFKNSDFGFSTPSEVVKNSKTVGAIHVPVPISW
ADEERDLTAWLGNEMQNEAFERLYEQERYVKKLDDPEIQRDWEYLQTSDHFYYMCTKFFS
DGSVHEYFSPYDTPYDAFINYMNALSDFILRVKEKVEEKALA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgtctgtttttatttccaggtccatcagccttttcgcgttaagccttatcgc
ttctttgaaattggagaagaccattattattgggacgattttctaaatcgaaatgtcgtc
agaaaagtagctcaaaagtgctacctacccatgaatgccctgttattagatttgatccat
aaatatcaagggaaattcaaagtggctttttcattatcaggaaccttcctcgatcagatt
gaagcttatgctcctgatgttttggaaagcttccaaaaactagtggctactggtcatgta
gagcttttaaatgaaacttattcccattcgctggcttccttaaaaagcaaagaagagttt
tttggattggtcgaaaaacaccaagcaaaaatcaaacaacttttcaatggctatactccc
aaagtcttccgaaatacagagcttatttattccgatcaaatcggagcgatggtctctgaa
ttgggctatgaggcaattcttaccgaaggtgcgaaacacgttttaggatggaaatctcca
aattatgtgtacaataactctatcaatcccaacctgaaagttctcctgaaaaacttcttg
ttgtcagatgatatcgcattcagattcagcaataaaacatgggctgattatccattgacc
acagacaaatttgtctcttggctcaatgctatcccaaaagaagaacaggtcgtcaacttg
tttatggattatgagacatttggagaacatcagtgggcagagactggaatatttgaattc
atgagacacttgcctgaggcaatcttcaaaaattccgattttggattttcaactccttct
gaagtagtgaaaaattcgaaaaccgtaggtgcaatccatgttccagtgccgatttcatgg
gcagatgaagagcgggatttgactgcatggttgggtaatgaaatgcaaaatgaagccttt
gagagattgtacgagcaagaacgctatgtgaaaaagctggacgatccagagattcagcgc
gattgggaataccttcagacttcggatcatttctattacatgtgtaccaagttcttttct
gatggttccgtgcacgaatatttcagcccttatgatactccttatgatgcctttatcaat
tacatgaatgctttgagcgacttcattcttcgtgtaaaagaaaaagttgaagaaaaagca
ctggcttaa

DBGET integrated database retrieval system