KEGG   Algoriphagus sp. M8-2: AO498_01705Help
Entry
AO498_01705       CDS       T04334                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
alm  Algoriphagus sp. M8-2
Pathway
alm00240  Pyrimidine metabolism
alm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AO498_01705
Enzymes [BR:alm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AO498_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AMQ55089
UniProt: A0A142EIY4
LinkDB All DBs
Position
360289..360873
Genome map
AA seq 194 aa AA seqDB search
MFVEPSLHIGKSSERKGQIEVICGSMFSGKTEELIRRLNRARIARLKVEIFKPSVDKRYH
EQDVVSHNETSIRSTPVNFAGDILLLSGDCDVVGIDEAQFFDQELVRVSQILANQGKRVI
LAGLDMDFEGKPFEPMPTLMAIAEYVTKVHAICMKCGDLAAFSYRLSASKEKVVLGEKDS
YEARCRNCYKEERT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtagagcctagcctacatattggaaaatcatccgaacgaaagggtcagattgag
gtaatctgtgggtccatgttttcaggcaaaactgaggagcttattcgcaggttgaataga
gctagaattgcgagattgaaagttgaaatttttaaaccatccgtagataaacgataccat
gaacaggatgtagtttcccataatgaaactagcatccgatcaactcctgtaaactttgct
ggggacattttacttctttctggggattgtgatgtcgtagggatagatgaagcgcaattt
tttgatcaagagctcgtaagggtctcccagattttagctaatcaaggtaagcgagtcatc
ttggctggattagacatggattttgaaggaaagccctttgagccaatgcccaccttgatg
gctattgccgagtatgttactaaagttcatgcgatttgtatgaagtgcggagacctggct
gctttttcttatcggctttcagcctctaaggaaaaggtggtattaggcgaaaaagactcc
tatgaagctcgatgtaggaattgctacaaagaagagcgcacttaa

DBGET integrated database retrieval system