KEGG   Alteromonas naphthalenivorans: ambt_00205Help
Entry
ambt_00205        CDS       T01513                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
alt  Alteromonas naphthalenivorans
Brite
Translation factors [BR:alt03012]
 Eukaryotic Type
  Elongation factors
   ambt_00205
 Prokaryotic Type
   ambt_00205
Mitochondrial biogenesis [BR:alt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ambt_00205
Exosome [BR:alt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ambt_00205
  Exosomal proteins of breast cancer cells
   ambt_00205
  Exosomal proteins of colorectal cancer cells
   ambt_00205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
54739..55920
Genome map
AA seq 393 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKTYGGSAQAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYEFPGDDLPVIQGSALKALE
GDAEWEKKIIELGEALDSYIPEPERAIDKPFILPIEDVFSISGRGTVVTGRVEQGIVKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKREDVERGQVLAKPGSIN
PHTKFEAEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGAVELPEGVEMVMPGDNLKFV
VELIAPIAMDEGLRFAIREGGRTVGAGVVAKIL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttgaacgtacgaaaccccatgtaaacgttggtactattggccac
gttgaccacggaaaaactactctaactgcggcaatcactactgttctttctaagacatac
ggtggttcagctcaggctttcgatcaaatcgataacgcgcctgaagaaaaagctcgtggt
attaccatctctacatctcacgtagagtatgacactcctactcgtcactacgctcacgta
gactgcccaggacacgctgattacgttaaaaacatgatcaccggtgctgcacagatggat
ggagctatcctagtagtagctgcgactgatggccctatgcctcagactcgtgagcacatc
ctacttggtcgtcaggttggtgttccttacatcatcgtattcatgaacaaatgtgacatg
gttgatgatgaagagcttctagagctagtagaaatggaagttcgtgaacttcttagcgaa
tatgaattcccaggcgatgaccttccagttatccaaggttctgcacttaaagctcttgaa
ggcgatgcagaatgggaaaagaaaatcatcgaacttggtgaagctcttgattcatacatc
ccagagccagagcgtgctatcgataagccgttcattcttccaatcgaagacgtattctca
atctcaggccgtggtacagtagtaacgggtcgtgtagagcaaggtattgttaaagttggt
gaagaagtagaaatcgttggtatcaaagatacgactaagacgacttgtactggtgttgaa
atgttccgtaaacttcttgacgaaggtcgcgctggtgagaacgttggtgttcttctacgt
ggtactaagcgtgaagacgttgaacgtggtcaagtactagctaagcctggttcaatcaac
ccacacactaaattcgaagctgaagtatacgtactaagcaaagacgaaggtggccgtcat
actccattcttcaaaggctatcgtccacagttctacttccgtacaactgacgtaactggt
gctgtagagcttccagaaggcgtagagatggtaatgcctggtgacaaccttaagttcgta
gtagagcttattgcaccaatcgcgatggacgaaggtttacgcttcgctatccgtgaaggt
ggccgtactgtaggtgctggtgttgtagctaagattctttaa

DBGET integrated database retrieval system