KEGG   Amycolatopsis lurida: BB31_24415Help
Entry
BB31_24415        CDS       T03710                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
alu  Amycolatopsis lurida
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alu00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BB31_24415
Enzymes [BR:alu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BB31_24415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5047043..5048221
Genome map
AA seq 392 aa AA seqDB search
MVAVTDLVAEAAALDAADPLAHKRNEFDLDASVAYFDGNSLGAPPKHVAERVAAVVREQW
GGRLIRSWSEGWWEAPVRVGERIAPLVGAAPGQLVVADSTSVNLFKALVAATRLQPGRDE
ILVDADTFPTDGYIADEVARLTGRTVRRVVAEDMPAQVSERTAVALINHVDYVTGRAHDM
AGLTAALHRAGALALWDLCHSVGALPVELDAAGVDLAVGCTYKFLNGGPGSPAFLYVATK
WLDSFDQPLAGWAGDRDPFAMRGAYEADAGIARGRAGTPDILSLLALDAALDVWDGVDRG
VLRTKGLALGDFFFRCADELLDGATIRTPRGEDRGHQISVADDDAAKTMAALIDRGVIGD
FRPPNVLRFGLAPLYTTYGEVLRAVTTLREFR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgtgactgacctcgtagccgaggccgcggcgctggacgcggccgatcccttg
gcgcacaagcgaaacgaattcgacctcgacgcgagcgtcgcctatttcgacggtaactcc
ctcggcgccccgccgaagcacgtggccgaacgcgtcgccgcggtcgtccgcgagcagtgg
ggcgggcggctcatccggtcctggtcggagggctggtgggaggctccggtacgggtcggc
gaacggatcgcgccgctggtgggagccgcgccggggcagctcgtcgtggcggattcgacc
agcgtgaacctgttcaaggcgctggtcgccgcgacccgcctccagcccggccgtgacgag
atcctcgtcgacgcggacaccttcccgaccgacggctacatcgccgacgaggtcgcccgg
ctgaccgggcgcacggtgcgccgggtcgtcgccgaggacatgcccgcccaggtgagcgag
cggacggccgtcgccctgatcaaccacgtcgactacgtcaccgggcgcgcccacgacatg
gccgggctgaccgcggcactgcaccgcgccggggcgctggcgctctgggacctctgccac
agcgtcggcgcgctgccggtcgagctcgacgcggcgggcgtggatctcgccgtcggctgt
acctacaaattcctcaacggtggccccggctcgcccgcttttctttacgtggcaacgaag
tggctggacagcttcgaccagccgctggcgggctgggccggcgaccgcgacccgttcgcg
atgcggggcgcgtacgaggcggacgcgggcatcgcacgaggccgcgcgggcacgcccgac
atcctttcgctgctggcgctggacgcggccctcgacgtctgggacggcgtggaccgcgga
gtgctcaggacgaaggggctcgcgctcggcgacttcttcttccggtgcgcggacgagctc
ctggacggcgcgacgatccggaccccgcgcggggaggaccgcggccaccagatctccgtc
gccgacgacgacgcggccaagacgatggcggccctgatcgaccgcggcgtgatcggcgac
ttccgcccgcccaatgtgctgcgattcgggctggcgccgctctacaccacctacggcgag
gtgcttcgcgccgtgacgacgctacgcgaatttcgatga

DBGET integrated database retrieval system