KEGG   Amycolatopsis lurida: BB31_38625Help
Entry
BB31_38625        CDS       T03710                                 

Definition
(GenBank) neuraminidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
alu  Amycolatopsis lurida
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:alu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BB31_38625
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BB31_38625
Enzymes [BR:alu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BB31_38625
Bacterial toxins [BR:alu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BB31_38625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(8017554..8019074)
Genome map
AA seq 506 aa AA seqDB search
MKISRVAQGLFAALVATAAVGAAPATSLAAPATGDRFSTTAVGNTLVYKQKTEGYDCFRI
PAIVKANNGELLAFAEGRNGGASFCNDRGDIDLVVKRSADNGKTWSAPKIVIEGFGDTKG
NPTPIVIPSTGRIVLLSVMECVKNPDCNRIPRVSISDDHGKTWTAPKVLTTQLGFNSAPG
WLATGPSHGIVLTRGAHAGRIVAGMSYTVDGKNSGALIYSDDQGVTWKRGATDTPASTAG
LNPQEISVTELLDGRVYAAARNQANNDDKCLSGGAKNRAYAISSDGGASFSTKFTFEEDL
ITPVVQASTARMTATDKAGKYNRILFAAPSVCDRRKELVVRSSFDEGANWQGNSAGTLVW
SGDAAYSDMVQLSSGSVGVLYEAGPAGNANETIRFSAVTETTLGAPACGGGYGVIDSAPL
GTAGTVYLSYNASNGQNCVSTMKSESAGTATATSAYLEVAGSSRITDSGSFSWFAGPVRA
AAAGKCVKWGGSAGGTAYNSPSEHCG
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatctcccgcgtcgcacagggcctgttcgcggccctcgtcgccaccgcggcggtc
ggcgcagccccggccacctccctcgccgcgccggccaccggcgaccggttttcgaccacc
gcggtcgggaacacgttggtgtacaaacagaaaacagaaggttacgactgcttcagaatc
cccgccatcgtcaaggcgaacaacggcgagctgctcgcgttcgccgaaggccgcaacggc
ggcgccagcttctgcaacgaccgcggcgacatcgacctcgtcgtgaaacggtccgccgac
aacggcaagacctggagcgctccgaagatcgtcatcgaaggtttcggtgacaccaaagga
aatccgacaccgatcgtgatcccgtccaccgggcggatcgtgctgctctcggtgatggaa
tgcgtcaagaaccccgactgcaaccggattccgcgcgtctcgatcagcgacgaccacggc
aagacctggaccgcgcccaaggtgctcaccacgcagctcgggttcaacagcgcaccgggc
tggctcgcgaccgggccgtcgcacggcatcgtgctgacccgcggcgcgcacgccggccgg
atcgtcgccggaatgagttacaccgtcgacggcaagaacagcggcgcgctcatctacagc
gacgaccagggcgtcacctggaagcgcggcgccaccgacaccccggcctcgacggccggg
ctgaacccgcaggagatcagcgtcaccgaactgctcgacggccgcgtctacgccgcggcg
cgcaaccaggccaacaacgacgacaaatgcctcagcggtggcgccaagaaccgcgcctac
gccatcagctccgacggcggggcgagcttctccaccaagttcaccttcgaggaggacctg
atcaccccggtggtgcaggcctcgaccgcgcggatgaccgcgaccgacaaggcgggcaag
tacaaccggatcctgttcgccgcgccatcggtctgcgaccgccgcaaggaactcgtcgtg
cggtcgtcgttcgacgagggcgcgaactggcagggcaactccgccggaacgctggtgtgg
agcggtgacgccgcgtactccgacatggtccagctgtcctcgggttcggtgggcgtgctg
tacgaggcgggcccggcggggaacgccaacgagaccatccgtttctcggccgtcaccgag
acgaccctcggcgccccggcgtgcggcggcggatacggcgtgatcgactcggcaccgctc
gggacggcgggcacggtttacctgtcctacaacgcttccaacgggcagaactgtgtcagc
acgatgaagagcgagtccgcgggcaccgcgaccgcgacgtcggcctacctcgaggtggcg
gggtcgtcgcggatcaccgactccgggtcgttctcgtggttcgccggtccggtgcgggcg
gccgcggcgggcaaatgcgtgaagtggggcggctccgcgggcgggacggcgtacaacagc
ccgtcggaacactgcggctga

DBGET integrated database retrieval system