KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_487699Help
Entry
ARALYDRAFT_487699 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:aly01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aly01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aly00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aly00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aly00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 510 aa AA seqDB search
MSNIDIEGILKELPNDGRIPKTKIVCTLGPASRTVSMIEKLLKAGMNVARFNFSHGSHEY
HQETLDNLRTAMHNTGILAAVMLDTKGPEIRTGFLKDGNPIQLKEGQEITITTDYDIKGD
ESTISMSYKKLPLDVKPGNTILCADGSISLAVLSCDPESGTVRCRCENSAMLGERKNVNL
PGVVVDLPTLTDKDIEDILGWGVPNSIDMIALSFVRKGSDLVNVRKVLGSHAKSIMLMSK
VENQEGVINFDEILRETDAFMVARGDLGMEIPIEKIFLAQKLMIYKCNLAGKPVVTATQM
LESMIKSPRPTRAEATDVANAVLDGTDCVMLSGESAAGAYPEIAVKVMAKICIEAESSLD
YNTIFKEMIRATPLPMSPLESLASSAVRTANKARAKLIIVLTRGGSTANLVAKYRPAVPI
LSVVVPVMTTDSFDWACSDESPARHSLIYRGLIPMLAEGSAKATDSEATEVIIEAALKSA
TQRGLCNHGDAVVALHRIGAASVIKICVVK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacatagacatagaagggatattgaaggagctacctaatgatggtaggatccca
aagacgaagatagtttgcactttaggaccagcttctcgcactgtttctatgatcgaaaag
cttttgaaagccggtatgaatgtcgctcgcttcaacttctcacatggaagccatgaatac
catcaagagacactcgacaacctccgcaccgctatgcataataccggcattctcgctgct
gtcatgcttgatactaagggacctgagatccgtactggtttcttgaaagatgggaaccct
atacaactgaaggaaggtcaagaaattactataaccactgattatgacattaagggagac
gagtcaacgatatccatgagctataaaaagctgcctttggatgtgaagcccggaaacacc
atactctgtgcagatggaagcataagtctagctgttttgtcatgtgatcctgagtctgga
acggttaggtgccgctgtgaaaactcggcgatgcttggtgaaagaaagaacgtgaatctt
cctggcgttgttgttgatcttcccactttgacagataaggatattgaagatattctcggt
tggggtgttccgaacagcatcgatatgattgctctttcgtttgtccgtaaaggttcggat
cttgttaatgtccggaaggttcttggatctcatgctaaaagcataatgctcatgtcaaag
gttgagaaccaggaaggagtgattaactttgatgagatcttgcgtgaaacagatgcgttc
atggttgcccgtggtgatctcgggatggagattccaatagagaagatcttcttggcgcaa
aagttgatgatctacaagtgtaaccttgcgggtaaaccggtggtcacagctactcagatg
ctggagtcaatgatcaaatcacctcggccaacccgagctgaagccacagatgttgcaaat
gctgttcttgatggcactgactgtgtgatgcttagcggtgagagtgcagcaggagcttat
cctgaaatagctgtgaaagtcatggcaaagatctgcattgaagccgaatcctcgcttgat
tataacacaatcttcaaagagatgatccgagcaactccgcttccaatgagcccactcgag
agtcttgcatcatccgctgtacggactgctaacaaagcaagggcgaaactcatcattgtg
ttgacacgtggaggttcaaccgctaaccttgtggctaaatacagaccggctgttccgatt
ctgtcagtggttgtcccggtcatgaccactgattcctttgactgggcttgtagtgacgag
tcacctgcaaggcatagtctgatatacagaggtttaatccctatgttggctgaaggatct
gcaaaggcaacagatagtgaagccacggaagttatcattgaagctgctctgaagtcggct
acacagagaggactgtgcaaccatggtgatgcagtcgtggcgctgcaccgtattggagct
gcctcagttattaagatctgtgtggtaaagtga

DBGET integrated database retrieval system