KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_489451Help
Entry
ARALYDRAFT_489451 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ARALYDRAFT_489451
Chromosome [BR:aly03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     ARALYDRAFT_489451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 387 aa AA seqDB search
MTDTRVISTWTELTRDSAIYLLFTFFAIKVYIFLFCCTRTSEMSSFSMATHPEALRRERI
LNSKLYFDVPLSKVSIIYSSAYDISFMGIEKLHPFDSSKWGRVCKFLVSDGFLEEKAIVE
PLEASKIDLLVVHSENYLNSLKSSATVARITEVPPVAFFPNFLVQQKVLYPFRKQVGGTI
LAAKLATERGWAINIGGGFHHCTAERGGGFCAFADISLCIHFAFLRLRISRVMIIDLDAH
QGNGHETDLGDDNRVYILDMYNPNIYPFDYRARRFIDQNIEVVSGTTTDEYLRKLDEALE
VASRNFQPELVIYNAGTDILDGDPLGLLKISPDGITSRDEKVFRFAREKSIPLVMLTSGG
YMKSSARVIADSIENLSRQGLIQTRPE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacagatacccgagtcatctcgacctggaccgagttaactcgcgactcagctatttac
ttgctcttcacgtttttcgccatcaaagtctacatatttctcttctgctgtactcgaacc
tctgaaatgtcatcgttttcgatggcgactcatcccgaagctctccggcgagaacgaatt
ctcaacagcaaactctacttcgacgttcctctttcaaaggtttcgattatctattcatcg
gcctatgatatttcgttcatgggtattgagaaattgcatccatttgattcttccaagtgg
ggtagagtttgcaagttccttgtttcagatgggtttttggaggagaaagcaattgttgag
cctcttgaagcttcaaagattgatcttttagtggtacattctgagaattacttaaacagc
ttgaaaagtagtgccactgtcgctaggataaccgaggttccaccagttgccttttttccg
aattttcttgtgcagcagaaagttctttacccattccgaaagcaggttggtgggacgatt
ctggcagctaaactcgcaacagaacgtggatgggcaataaatattggaggaggttttcat
cattgtactgcggaaagaggaggcggattttgtgcttttgctgatatttctctctgtatt
cactttgcatttcttcgtctgcgaatctccagggttatgataatagatcttgatgctcat
caagggaatggccacgaaacagatctcggcgatgacaaccgcgtttacattctggatatg
tacaatcccaatatatacccttttgattatagagctaggagatttatcgatcagaacatt
gaggtcgtgagcgggaccaccaccgatgagtatttgaggaaactagatgaagcccttgag
gttgcttcgcgaaacttccaaccggagttggtaatttacaatgctgggacagatatatta
gatggtgaccctctgggacttctaaagataagccctgatggcataacgagtagagacgag
aaagtcttcagatttgcaagggagaaaagtattcctcttgtgatgctaacttcaggcggg
tacatgaagtcaagcgccagagttattgcggattccattgagaatctctcacgacaaggg
ttaatccagacacgaccggaataa

DBGET integrated database retrieval system