KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_495726Help
Entry
ARALYDRAFT_495726 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00010  Glycolysis / Gluconeogenesis
aly00230  Purine metabolism
aly00620  Pyruvate metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
aly01230  Biosynthesis of amino acids
Module
aly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aly_M00002  Glycolysis, core module involving three-carbon compounds
aly_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
aly_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_495726
   00620 Pyruvate metabolism
    ARALYDRAFT_495726
  Nucleotide metabolism
   00230 Purine metabolism
    ARALYDRAFT_495726
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     ARALYDRAFT_495726
Membrane trafficking [BR:aly04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ARALYDRAFT_495726
Exosome [BR:aly04147]
 Exosomal proteins
  Proteins found in most exosomes
   ARALYDRAFT_495726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 9300528
NCBI-ProteinID: XP_002866137
UniProt: D7MLQ2
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MAMIEQRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLHQAM
LNTGILCAVMLDTKGPEIRTGFLKDGKPIQLKQGQEITISTDYDLKGDENTICMSYKKLA
VDVNPGMVILCADGTISLLVLSCDKENGTVRCRCENSAMLGERKNVNLPGVVVDLPTLTE
KDKEDIMQWGVPNQIDMIALSFVRKGSDLVQVRKLLGKHAKNILLMSKVENQEGVANFDD
ILVNSDAFMIARGDLGMEIPIEKIFLAQKVMIYKCNIQGKPVVTATQMLESMIKSPRPTR
AEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICVEAESTLDYGDVFKRIMLYS
PVPMSPLESLASSAVRTANSARATLIMVLTRGGSTARLVAKYRPGMPILSVVVPEIKTDF
FDWSCSDESPARHSLIFRGLIPVLYAGSARASHDESTEEAIEFATQYGKEKELCKTGDSV
VALLRVGNASVIKILTVK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatagagcaaaggccgaagacgaagatcgtttgtactctaggtccagcttcc
agatctgttccaatggtcgagaagcttcttagggctggtatgaacgttgctcggtttaat
ttctcacatggatctcatgaataccatcaagagactcttgataatcttcatcaagctatg
cttaatactgggattctctgtgccgtcatgctcgataccaagggtccagaaatccgaacc
gggttcttgaaagatgggaaaccaatccagctgaaacagggccaagagatcaccatttcg
actgactatgacttgaagggtgacgagaacacgatttgcatgagctacaaaaagttggct
gtagatgtgaacccaggaatggtcatactttgcgctgatgggacaatctcgttactggtc
ctctcttgtgacaaagagaatggtacagtccgttgccggtgtgagaacagtgcgatgctc
ggtgagaggaagaacgtcaatcttccaggtgttgttgtggatctcccaactttaactgag
aaagacaaagaagacatcatgcaatggggagtcccgaatcaaatcgacatgattgctctg
tcttttgtcagaaaaggttcagacttggtccaggtccggaaacttctaggaaagcacgca
aaaaacattcttctcatgtctaaggttgagaaccaagaaggtgttgcaaattttgatgac
attttggtgaattcggatgctttcatgattgccagaggagatctgggaatggaaatccca
attgagaagatcttcctagctcagaaggtgatgatatacaaatgcaacatccagggaaaa
cctgtggtcacagcgactcagatgctcgagtccatgatcaagtctcctcgacccacaagg
gccgaagccacagatgttgcaaacgcagtcctcgacggtacagactgtgtcatgctcagt
ggtgaaactgcagctggagcataccctgaactagctgtccgtacaatggctaagatctgc
gtggaagccgagagcaccctcgactacggagatgtcttcaagaggatcatgctgtactct
ccagttccaatgagcccactcgagtcactcgcatcctcagcagtaagaactgctaactca
gctagagctactctcatcatggtcctaaccagaggaggaagcacagcaagacttgttgct
aagtacagaccaggaatgcctattctatccgtcgttgttcctgagatcaaaaccgacttc
tttgactggtcttgcagcgatgagtccccagctagacacagccttatcttccgtggtcta
atcccggtgctctacgctggatccgctagagcctcacacgatgaatcaacagaagaagct
attgagtttgctactcagtacgggaaagagaaagagctgtgcaagactggagactccgtt
gttgctctactccgagtcggtaatgcttccgtgatcaagatcttgacggtcaagtga

DBGET integrated database retrieval system