KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_910314Help
Entry
ARALYDRAFT_910314 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00240  Pyrimidine metabolism
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ARALYDRAFT_910314
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ARALYDRAFT_910314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 cobW ATPase_2
Motif
Other DBs
NCBI-GeneID: 9310178
NCBI-ProteinID: XP_002872033
UniProt: D7M1M5
LinkDB All DBs
Position
Unknown
AA seq 281 aa AA seqDB search
MFGVSMRTLISPSLAPFSLHLPKPSLFSTALRFSSLTTSTISINNRSPTNAPPSAISTRK
LQTKATAPLSFTTPGEIHVVVGPMFSGKTTTLLRRILAEKETGKQIAIIKSNKDTRYCTE
SIVTHDGEKFPCWSLPDLSSFKERFGFDEYENRLDVIGIDEAQFFGDLYEFCRQAADREG
KTVIVAGLDGDFKRRRFGSVLDLIPIADTVTKLTSRCEVCGKRALFTMRKTEEKETELIG
GAEVYMPVCRSHYVCGQSVLETARAVLDSSSNKHDVVASLL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtgtttcgatgagaacattaatctcaccatctcttgctcctttctctcttcat
ctccctaaaccttctctcttctccaccgctcttcgcttctcctccctcaccacttccacc
atctcaatcaacaacagatcccccacaaatgcacctccctccgccatttccaccagaaaa
ctacaaacgaaagcgacggcgccgctctctttcacaactcccggcgaaatacacgtagtc
gtcggaccaatgttctccggtaaaaccacaacacttctccgccgtatcctcgccgaaaaa
gaaaccggtaaacaaatcgcaatcatcaaatcaaacaaagacacaagatactgcactgaa
tcaatagttactcacgacggtgagaaattcccttgctggtcacttcccgatctctcgtcc
ttcaaagagaggttcggattcgacgaatacgagaatcgattagatgtgattggaatcgac
gaagctcaattcttcggagatctatacgagttttgccgtcaagctgctgatagagagggt
aaaactgtaattgttgctggattggatggtgattttaagcggaggaggtttggttcggtg
cttgatttgattccaattgcggatacggttacgaagctgacgtcacggtgtgaggtttgt
gggaagagagctttgtttacgatgaggaagacggaggagaaagagacggagttgatcggc
ggagctgaagtttatatgcctgtgtgtcggagtcattacgtttgcggtcaaagcgttttg
gaaaccgctcgtgccgttttggattcttcaagcaataagcatgatgttgtagcaagtttg
ctttaa

DBGET integrated database retrieval system