KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_913598Help
Entry
ARALYDRAFT_913598 CDS       T01578                                 

Definition
(RefSeq) ATHXK1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_913598
   00051 Fructose and mannose metabolism
    ARALYDRAFT_913598
   00052 Galactose metabolism
    ARALYDRAFT_913598
   00500 Starch and sucrose metabolism
    ARALYDRAFT_913598
   00520 Amino sugar and nucleotide sugar metabolism
    ARALYDRAFT_913598
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ARALYDRAFT_913598
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     ARALYDRAFT_913598
Membrane trafficking [BR:aly04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    ARALYDRAFT_913598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MGKVAVGATVVCTAAVCAVAVLVVRRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVAD
AMTVEMHAGLASDGGSKLKMLISYVDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQER
VVKQEFEEVSIPPHLMTGGSDELFNFIAEALAKFVATECEDFHLPEGRQRELGFTFSFPV
KQTSLSSGSLIKWTKGFSIEEAVGQDVVGALNKAMERVGLDMRIAALVNDTVGTLAGGRY
YNQDVVAAVILGTGTNAAYVERATAIPKWHGPLPNSGEMVINMEWGNFRSSHLPLTEFDH
SLDFESLNPGEQILEKIISGMYLGEILRRVLLKMAEDAAFFGDTVPSKLRIPFIIRTPHM
SAMHNDTSPDLKIVGSKIKDILEVPTTSLKMRKVVLSLCNIIATRGARLSAAGIYGILKK
LGRDTTKDEEMQKSVIAMDGGLFEHYTQFSDCMESSLKELLGDEASGSIEVTHSNDGSGI
GAALLAASHSLYLEDS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtagctgttggagcgactgttgtttgcacggcggcggtttgtgcggtggct
gttttggttgttcgacgacggatgcagagctcagggaagtggggacgtgttttggccatc
cttaaggcttttgaagaggattgtgcgactccgatctcgaaactgagacaagtggctgat
gctatgaccgttgagatgcatgctggtcttgcatccgacggtggtagcaaactcaaaatg
cttatcagctacgttgataatcttccttctggggatgaaaagggtctcttttatgcattg
gacctaggtggaacaaacttccgtgtcatgcgtgtgcttcttggcgggaagcaagagcgc
gttgttaaacaagaattcgaagaagtttcgattcctccccatttgatgactggtggttca
gatgagttgttcaattttatcgctgaagctcttgcgaagtttgtcgccacagaatgcgaa
gactttcatctcccggaaggtagacagagggaattaggtttcactttctcgtttccggtt
aagcagacttctttatcctctggtagtctcatcaaatggacaaaaggcttttccatcgaa
gaagcagttggacaagatgttgttggagcacttaataaggctatggaaagagttgggctt
gacatgcgaatcgcagcacttgttaatgataccgttggaacactagccggtggtagatac
tataaccaggatgttgttgctgctgttattttaggcactgggacaaacgcagcctatgtt
gagcgtgcaacggcaatccccaaatggcatggtccgcttccaaactcaggagaaatggtt
ataaacatggaatggggaaacttcaggtcatcacatctcccattaacagagtttgatcac
tctctggatttcgagagtctgaatccaggcgaacagattcttgagaaaatcatttccggt
atgtacttgggagagattttgcgaagagttcttctaaagatggctgaagatgctgctttc
tttggcgataccgtcccatctaagctgagaataccattcatcattaggacccctcacatg
tcggctatgcacaacgacacttctccagacttgaagattgttgggagcaagattaaggat
atattggaggtccctacaacttctctgaaaatgagaaaagttgtgctcagtctctgcaac
atcatagcaacccgaggcgcccgtctctctgctgctggaatctatggtattctgaagaaa
ctgggaagagatacgaccaaagacgaggagatgcagaaatcggttatagccatggatggt
ggattgtttgagcattacactcagtttagtgactgtatggagagctcactaaaagagttg
cttggagatgaagcttcaggaagcattgaagtcactcactccaatgatggatcaggcatt
ggagctgcgcttcttgcagcttctcactctctgtaccttgaagactcttaa

DBGET integrated database retrieval system