KEGG   Alteromonas mediterranea U7: I876_15670Help
Entry
I876_15670        CDS       T02721                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
amae  Alteromonas mediterranea U7
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amae00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    I876_15670
  Lipid metabolism
   00600 Sphingolipid metabolism
    I876_15670
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    I876_15670
Enzymes [BR:amae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     I876_15670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3549816..3552533
Genome map
AA seq 905 aa AA seqDB search
MLFIRNYKGLLALTLLLLATNVTAKQREKIDFTGEWRFYRYADNQTPDSLIYDTRPNVNQ
FDDSQAADTRPSDAVTVNSHDGVLKSWILPTGNAFIANPDKRHVRPEGEPGKDFPFVQRA
FDDSHWKVVNLPHDWAIAGPFYSGNNPKVGGGMGRLPSHGVAWYRKQFTLAKDDKNKRIY
LHIDGAMSYSMVWLNGHLVGGWPYGYSSYQLDLTPYVTVGQTNQLAIRLDNPPKSSRWYP
GGGIYRNVWFEKTAQIHISQWGTQVITPTVSKDKATISITTSIRNHTKNDQNVSLQHHIY
ELSKQDTLSENPVLTLPSQALTLASGEEQKSQATSVLKNPKLWGPIPHQTPHRYAVVTSV
IQNGKTLDQYTTPFGVRKLAFNPDTGVVVNGEHIPLQGVNQHHDLGALGAAFNLRAAQRQ
LNILQEMGVNAIRMAHNPPAPELLTLTDKMGILVLNESFDSWYKKKTPLDFHLIFADWHE
QDLRALVRRDKNHPSVIMWYIGNEVGEQYTGEEGAEIALKLKSIVKSEDPTRPVTASMNW
AKADFPFSAAMDVISLNYQGEGIRQEPEFENTDRIRTPPSYPAFREAHPDKVILSSETAS
AYSSRGLYFFPVTPKTSAPVRDGLGGNSKIHQVSSYELHAVDFGASADKVFRYLDTYPFV
AGQFVWNGFDYLGEPTPYYAARSSYSGMIDLAGFKKDRFYLYQSEWRPDLPMAHILPHWN
WSGREGEITPVHVFTSGDEAELFINGQSQGKKKKGPFEYRLRFDDVRYTPGTVEMVTYKN
GKRWATDSVTTSGVPSGLRLSADRNIINADGKDLSFVTVDIVDKKGNPVPTATHRVHFSL
TGPGRIVATDNGDSTNFTPFPSHERKAFSGKLLVIIQSEHNKPGELKLTASSQALEPAVL
TLRAN
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgctatttattaggaattataagggactacttgcccttaccttgctactgttagccaca
aatgttacagccaagcaacgagaaaaaattgattttactggagaatggcgattttaccgc
tacgccgataatcaaacgcctgatagcttgatttacgatactcgccccaacgttaaccag
tttgacgacagccaagcggcggatactcgcccttccgatgcggtaacagttaatagccac
gatggcgtattaaaatcctggattcttcccacgggaaatgcgtttattgctaaccccgat
aagcgccatgtaagacccgaaggcgaaccaggcaaagattttccatttgttcagagagcg
ttcgatgacagccattggaaagtggttaatttacctcacgactgggccatcgcagggcca
ttctatagtggcaacaatcctaaagtggggggcggtatgggacgtctaccctcccacgga
gtagcgtggtatagaaagcagtttacgcttgctaaagacgataaaaacaaacgtatttat
ctgcatatagacggcgcaatgtcttactcaatggtatggctaaatggtcatcttgtcggg
ggttggccttatggttatagctcttatcaacttgatcttacgccctatgtcactgttgga
caaaccaatcaacttgctattcgacttgataacccgccgaaatcttctcgctggtatccc
ggtggcggtatctatcgaaatgtatggtttgaaaaaaccgcacagatccatatcagtcag
tggggaacgcaggtgatcacacctaccgtgtctaaggacaaggccacgatatcgattacc
acatcaatcagaaatcatacgaaaaatgatcagaacgtgagtcttcaacaccatatttat
gagctttcaaagcaagatacccttagcgaaaatccggtattaacgcttccttcccaagct
ttaacgttagcttctggagaagaacaaaaaagccaagctacttctgtgttaaagaacccc
aagttatgggggcctataccccatcaaacaccccatcgctatgcagtggttacgtcagtc
atacagaacggaaaaacacttgaccaatacaccacgcccttcggcgttcgcaagttggcg
ttcaaccctgataccggcgtggtcgtcaatggtgagcacattccgctacaaggtgttaac
cagcaccatgatttgggcgccctgggcgctgcatttaatttgcgggctgcccagagacaa
ttaaacattcttcaggaaatgggggtaaacgctattcgcatggcacataatcctcccgcg
cccgaacttctgacattaacggataaaatgggaattctagtattaaacgagtcgttcgac
agttggtacaagaaaaagacaccacttgattttcaccttatttttgccgattggcatgaa
caagatcttcgcgcgctagttcgacgcgacaagaaccatccttcggtgatcatgtggtat
atcggtaatgaagttggagaacaatataccggagaagaaggggctgaaatcgccttaaaa
ctaaaaagtattgttaagagtgaggaccctacccgccctgttactgcatctatgaattgg
gctaaggctgatttcccgtttagcgcagctatggacgtaataagcctaaactatcaaggg
gaaggcatccgccaagagcctgaatttgaaaataccgaccgtattcgcactcccccctct
tatcccgcttttcgcgaagcacaccccgataaagtaattttatctagtgaaacagcctcc
gcttacagctctagagggctttacttctttcctgttacaccgaaaaccagtgcgccggtt
cgcgatggtcttggtggaaattcaaaaattcatcaagtcagtagctacgagctacatgcg
gtagattttggggcatcagccgataaagtttttcgctatctagatacctacccttttgtt
gctgggcagttcgtatggaatggttttgattacctaggtgaacccacgccctactatgcc
gcgcgaagctcttattccggcatgatcgatctggctggtttcaaaaaggatcgcttctac
ctctatcagagcgaatggcgaccggatctgcctatggctcatattcttccccattggaat
tggtccggtagagagggagaaatcactcctgttcatgtgtttacctccggagatgaagca
gagctatttattaatgggcaatcacaagggaagaaaaagaaaggtccctttgaatatcga
cttcgctttgatgatgttcgctacacgccgggaacagtagaaatggttacctataagaac
ggcaagcgatgggcaaccgacagcgtaacaacttctggcgtcccctcaggtttacgttta
tccgcagatcgcaatatcatcaatgccgacggaaaggatctatcatttgttaccgttgat
atcgtagataaaaagggtaatccagtacccactgcgactcaccgcgttcacttttcgctc
actgggcctggccggatagtcgcaacagataatggagattcgacaaacttcactccattt
ccttctcacgagaggaaggcgtttagtggaaagctacttgttatcattcaaagtgaacac
aacaagcctggagaattaaagcttaccgcgagcagccaagctttagagcctgcagtcctg
acactgcgtgcaaactaa

DBGET integrated database retrieval system