KEGG   Alteromonas mediterranea U7: I876_17830Help
Entry
I876_17830        CDS       T02721                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
amae  Alteromonas mediterranea U7
Brite
Translation factors [BR:amae03012]
 Eukaryotic Type
  Elongation factors
   I876_17830
 Prokaryotic Type
   I876_17830
Mitochondrial biogenesis [BR:amae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    I876_17830
Exosome [BR:amae04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   I876_17830
  Exosomal proteins of breast cancer cells
   I876_17830
  Exosomal proteins of colorectal cancer cells
   I876_17830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4055128..4056312)
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKTYGGSAQAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLNEYEFPGDDLPVIQGSALKALE
GDAEWEKKIIELGEALDSYIPEPERAIDKPFILPIEDVFSISGRGTVVTGRVEQGIIKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLAKPGSIT
PHVNFEAEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGAVELPEGVEMVMPGDNLKFK
VELIAPIAMEEGLRFAIREGGRTVGAGVVSKILD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttgaacgtacgaaaccccacgtaaacgtgggtacaatcggccac
gttgaccatggtaaaactactctaactgcagctatcactacagttctatctaaaacttac
ggcggttctgctcaggcgttcgatcaaatcgataacgcacctgaagagaaagcgcgtggt
atcaccatctctacttcacacgtagagtacgatactcctactcgtcactacgcacacgta
gactgcccaggacacgctgattacgttaaaaacatgatcactggtgctgctcagatggac
ggtggtatcctagtagtagctgcgactgatggccctatgccacagactcgtgagcacatc
ctacttggtcgtcaggttggtatcccttacatcattgtattcatgaacaaatgtgacatg
gttgatgatgaagagcttctagagctagtagaaatggaagttcgtgaacttctaaacgaa
tacgaattcccaggtgatgacctaccagttatccaaggttcagctcttaaagcgcttgaa
ggcgacgcagagtgggaaaagaaaatcatcgagcttggtgaagcgcttgattcatacatc
ccagagccagagcgtgcratcgacaagccgttcatycttccaatygaagaygtattctca
atctcaggccgtggtactgttgtaacrggtcgtgttgagcaaggtatcatcaaggttggt
gaagaagtagaaatcgtaggtatcaaagatacgactaagactacttgtactggtgttgag
atgttccgtaagcttcttgacgaaggccgtgcaggtgagaacgttggtgttcttctacgt
ggtactaagcgtgatgaagttgaacgtggtcaagtactagctaagcctggttcaatcact
ccacacgttaacttcgaagcagaagtatacgtactgtctaaagatgaaggtggycgtcat
actccattcttcaaaggctaccgtccacagttctacttccgtacaactgacgtaactggt
gctgtagagcttccagaaggcgtagaaatggtaatgcctggtgacaaccttaaattcaaa
gttgagctaattgctccgatcgcgatggaagaaggtcttcgtttcgcaatccgtgaaggt
ggtcgtacagtaggtgctggtgttgtatctaagatcctagactaa

DBGET integrated database retrieval system