KEGG   Alteromonas mediterranea MED64: I533_16440Help
Entry
I533_16440        CDS       T02958                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
amag  Alteromonas mediterranea MED64
Brite
Translation factors [BR:amag03012]
 Eukaryotic Type
  Elongation factors
   I533_16440
 Prokaryotic Type
   I533_16440
Mitochondrial biogenesis [BR:amag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    I533_16440
Exosome [BR:amag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   I533_16440
  Exosomal proteins of breast cancer cells
   I533_16440
  Exosomal proteins of colorectal cancer cells
   I533_16440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3736957..3738141)
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKTYGGSAQAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLNEYEFPGDDLPVIQGSALKALE
GDAEWEKKIIELGEALDSYIPEPERAIDKPFILPIEDVFSISGRGTVVTGRVEQGIIKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLAKPGSIT
PHVNFEAEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGAVELPEGVEMVMPGDNLKFK
VELIAPIAMEEGLRFAIREGGRTVGAGVVSKILD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttgaacgtacgaaaccccacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaactaccctaactgcagctatcactacagttctttctaaaacttac
ggcggttctgctcaggctttcgatcaaatcgataacgcgcctgaagagaaagctcgtggt
atcaccatttctacttcacacgtagaatatgacacgcctactcgtcactacgcacacgta
gactgcccaggacacgctgattacgttaaaaacatgatcactggtgctgctcagatggac
ggtggtatcctagtagtagctgcgactgatggccctatgccwcagactcgtgagcacatc
ctacttggtcgtcaggttggtatcccttacatcatcgtattcatgaacaagtgtgacatg
gttgatgatgaagagcttctagagctagtagaaatggaagttcgtgaacttcttaacgaa
tacgaattcccaggtgatgacctaccagttatccaaggttcagctcttaaagcgcttgaa
ggcgacgcagagtgggaaaagaaaatcatcgagcttggtgaagcgcttgattcatacatc
ccagagccagagcgtgcaatcgacaagccgttcatccttccaattgaagatgtattctca
atctcaggccgtggtactgttgtaacgggtcgtgttgagcaaggtatcatcaaggttggt
gaagaagtagaaatcgtaggtatcaaagatacgactaagactacttgtactggtgttgag
atgttccgtaagcttcttgacgaaggccgtgcaggtgagaacgttggtgttcttctacgt
ggtactaagcgtgatgaagttgaacgtggtcaagtactagctaagcctggttcaatcact
ccacacgttaacttcgaagcagaagtatacgtactatctaaagatgaaggtggccgtcat
actccattcttcaaaggctaccgtccacagttctacttccgtacaactgacgtaactggt
gctgtagagcttccagaaggcgtagaaatggtaatgcctggtgacaaccttaaattcaaa
gttgagctaattgctccgatcgcgatggaagaaggtcttcgtttcgcaatccgtgaaggt
ggtcgtacagtaggtgctggtgttgtatctaagatcctagactaa

DBGET integrated database retrieval system