KEGG   Alteromonas mediterranea U4: I607_14630Help
Entry
I607_14630        CDS       T02720                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
amal  Alteromonas mediterranea U4
Pathway
amal00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:amal00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    I607_14630
Enzymes [BR:amal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     I607_14630
Transporters [BR:amal02000]
 Other Transporters
  Pores ion channels [TC:1]
   I607_14630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: AGP86711
LinkDB All DBs
Position
complement(3283273..3283905)
Genome map
AA seq 210 aa AA seqDB search
MYTLYGYPKTRSVRVAWALEEIGLPYEYKLIDLKQGQHLSDEYKAVSPSAKIPVLATPEG
TLSESAAIVTYLAERHGMQEFIPEPGSFSRAKYEEMMLFLTSELEQPVWNLAKHTFALPE
SQRLEEMHGVSAWEFQRALRVFASMLGGNEFVCGNMFTMADVIAGHILAWAKGSKLAIDF
QNISDYAQRVLSREAYERAWRGEMSHLPAQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtatacactttacggttaccctaaaacccgctcggttcgtgtagcgtgggcgctggaa
gaaattggtttaccttacgaatacaaactaatcgacttgaaacaaggtcagcatttgtct
gatgaatataaagcagtaagcccatcggcgaaaataccggtgttggcaacccccgagggc
acactgtctgagtcagctgccattgtcacttacttggctgagcgccacggtatgcaagaa
tttattcccgagcctggcagtttctcgcgggctaagtacgaagagatgatgctatttctc
accagtgagctagaacagccggtttggaatttagccaagcacacgtttgctttacccgaa
tcgcaaagattggaggaaatgcacggcgttagtgcgtgggagtttcagcgtgcgctcagg
gtgtttgcttctatgcttggcggtaacgaatttgtttgcggtaacatgtttactatggcc
gacgttattgcagggcatattttagcgtgggctaagggcagtaagttagcaatcgacttt
caaaatataagtgactacgcacaacgtgtactgtcacgagaagcctatgagcgtgcgtgg
cgcggcgaaatgtcgcacttacccgctcaataa

DBGET integrated database retrieval system