KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_14930Help
Entry
AMBAS45_14930     CDS       T02253                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AMBAS45_14930
Enzymes [BR:amb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AMBAS45_14930
Transporters [BR:amb02000]
 Other Transporters
  Pores ion channels [TC:1]
   AMBAS45_14930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3504087..3504728)
Genome map
AA seq 213 aa AA seqDB search
MYTLYGYPKTRSVRVAWALEELGLPFDYNLVDLKQGQHLTEEFKAISPASKIPALATAEG
TLTESAAIVTFLAERHGMHEFIPEPGSFERAKYEEMMLFLTSELEQPIWNLAKHTFALPK
EQRLEQMRDVAMWEFKRVLPVFSSMLGDKEFVCGTMFTMADIIAGHILAWAKGSKLDITL
DGKTGNVAEYAQRVLGREAYERAWRKEMAHLPE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtacacactttacggatatccgaaaacccgctcggttcgcgtggcatgggcactggaa
gagctaggtttaccttttgactacaacttggttgacttaaagcaggggcaacacctgaca
gaagaatttaaagccattagtccagcctcgaaaattccagcgctagcgacagcggaaggt
accttgaccgagtcagccgctattgtcacttttttagctgaacgtcacggcatgcacgaa
ttcattccagagcctggtagcttcgagcgagccaaatatgaagaaatgatgctattcctt
accagcgaattggagcaacccatttggaatttagcaaagcacacctttgcgttgcctaaa
gagcaaaggcttgaacaaatgcgtgatgtagcgatgtgggagtttaagcgagtgttgccc
gtattttcttctatgctgggcgataaagaatttgtatgcggcaccatgtttaccatggcc
gacataatagcaggtcatattttggcgtgggcaaaaggcagtaagctagatatcacgcta
gacggtaaaacaggcaatgtagccgagtacgcacaacgtgtattaggccgtgaggcgtat
gagagggcgtggcgaaaagagatggctcatttgcctgaataa

DBGET integrated database retrieval system