KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_14935Help
Entry
AMBAS45_14935     CDS       T02253                                 

Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Brite
Enzymes [BR:amb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AMBAS45_14935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3505148..3505693
Genome map
AA seq 181 aa AA seqDB search
MKKRLLSTLAGSLTLMLSASSFAGHHDNDGKEVIMNNLETGMSMGSVVVSSYDDDGVVFT
PNLSGLTPGIHGFHVHQNGDCSPSMKDGQKVLGGAAGGHFDPEGTGKHRAPWSEKGHEGD
LPVLYVDENGNATQPIFAPELELDDIEGRALMIHAGGDNYSDSPKKLGGGGDRVACGVIG
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacgtttactatctaccttagcaggctcactgacattaatgttaagtgcgagc
agtttcgcaggccatcatgataacgatggaaaagaagtgataatgaataacctggaaaca
gggatgagcatgggctcagtagtggtgagcagttatgatgatgacggtgtagtatttacg
ccaaacctgtcagggttaacgccaggcattcatggttttcatgtccaccaaaatggtgac
tgttcaccctcaatgaaagatggacaaaaagtgttgggcggcgcagcgggcggccatttc
gatccagaaggtaccggtaaacaccgtgctccttggtctgagaagggtcacgagggcgat
ctacccgtgctttatgttgatgaaaatggaaacgcaacccagcctatctttgcaccagag
cttgagttagatgatattgaaggccgcgccttaatgattcacgcaggtggcgacaattac
tctgattcacctaaaaagttaggtggcggtggtgaccgcgtagcatgtggcgtaattggg
aaataa

DBGET integrated database retrieval system