KEGG   Apis mellifera (honey bee): 411070Help
Entry
411070            CDS       T01057                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
ame  Apis mellifera (honey bee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    411070
Enzymes [BR:ame01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     411070
Chromosome [BR:ame03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     411070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BEEBASE: 
LinkDB All DBs
Position
LG5
AA seq 1328 aa AA seqDB search
MELRLHSPAGAEPIVYQWPLTSGSGSDRHDGALDVVETMRWVCEDLPDLKLPLENNILCD
YDTRDYESMKNLCDRFNRAIDSLVQLEKGTSLPSQRLNKRPSRGLLKHILQQTYNQAVVE
PDKLNQYEPFSPEVYGETSYELVCQMIDQIDVTEDDVFVDLGSGVGQVVLQMAAATLCKI
CIGVERADVPSRYAQSMEVNFRKWLNWYGKRCGEYRLVKGDFLADEHRESITGATIVFVN
NFAFGPTVDHQLKERFADLRDGARIVSSKSFCPLNFRITDRNLSDIGTIMHVSEMSPLKG
SVSWTGKPVSYYLHVIDRTKLERYFHRLKNNKQGGDENSDSVINNTASSSNKITNRSERG
DRAKRDLSRQLESPNHSEQQGTNSDSDIDENNIKNRRQPNKIRRKLNRKSNGITRPPARG
RQRGRGVKKSKPKKAINISGLDLLHSQTLLSTSPQALGKKPPPAPGCVDQQLSSLSLSLQ
SHSTSVHEELSIPPAPSATPYALQILLDLYRDQFMLMLESMRTPSYRVSVNTDIAKERER
NSKLQSRAAQLEKQIKVLIDDSVALLKARMTELGINATSPGDLLAKAKEIVLRHKQLQAK
ASKLQAQVASMESEQSRLTALRHQELQEKYNSLTNTNGISNPPQPLTQDYILKEISATLS
QRKRLHCQVSKLEHELNVLERASSEKQVAAIAQQQREASSKHSQNQHHQQQNGKSGSSRK
NREGRSRSQEWPDVPDIGKIQENNPEILAQKILETGRQIEAGRILRQNTNTSNNSRTRLP
QASLSFSTTSSISSSQTQINNKETTNRTQEPPRVANFEDRLKSIITSVLNEDQQNRNKQQ
QMQLQVQLQNQTEQDRKRITLPQNVSTPDYTQVSPAKLALRRHLSQERLSSHLTPPDRPT
IDSRQSSHDNRIVTGGNGLLGTRTIGDLVSGEIERTLEISNQSIINAAVDMSAMIRPETV
YSPISRPASAEGDAGLSTLAHVASYAPTCSAVSTCTPTTTSRSSVLFTPVTQPQRYTPVQ
LPRADIKPYHESYFSDNPSQSLTQSHPPPSLHSSQTTSNGELLPVEGLAASLHARILNNH
NTKTESILTTNRRFQPYPRYATSSNNNGSATTNGMVTAICQSQSSMSVKTEAVVSSVSTS
GAPLSPLVEPHSNTSTPLVDEPQMTTQRQRNGIGDDDGEADWQDRISSGFDRLVAFASTE
LDKRRRSTEGVNTSPDSGLGSDSTVTGPPPVIPSPDEALGPPRTPSPTSPRPPNPSNGST
SSNSSSNSSTSSVPLKYQRQLDPERHHFKKKFFHRDWNNSGSTSKFRPKGKDWDWNHSGQ
WPSNDEQS
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcgcctgcactcgccagccggagcagaaccgatcgtctatcaatggcccctt
acttctggatccggatctgatcgtcacgatggtgcacttgatgttgttgaaacaatgaga
tgggtttgtgaagatttgccagatttaaaactaccattagaaaataacattttatgtgat
tatgacacaagagattatgaaagtatgaaaaatttatgtgacagatttaatagagcaatt
gatagtttagttcaattggagaaaggcactagtttaccatcacaaaggttaaataaaaga
cctagtcgaggtttattaaaacatatacttcaacaaacatataatcaagcagtagtggaa
ccagataaattaaatcaatatgaacctttttcaccagaagtttatggagaaacaagttat
gaattagtatgtcaaatgattgatcagattgatgtaacagaagatgatgtatttgttgat
ttgggatctggagttggtcaagtagttctacaaatggctgcagctactttgtgtaaaatt
tgtattggtgttgaaagagctgatgtaccatcaagatatgcacagagtatggaagtaaac
tttcgtaaatggttgaattggtatggaaaaagatgcggcgaatatcgtttggtaaaaggc
gattttttagctgatgaacatcgtgaaagcattaccggagctacaatagtatttgtcaat
aattttgcattcggtccaacagtggatcatcaattaaaggaacgatttgctgatttacgg
gatggtgcacgcattgtatcatcaaaatcattttgtcctcttaattttcgcataacggat
agaaatctcagtgatattggcacaataatgcatgtctcggaaatgtcaccgctgaaaggt
tctgtctcgtggactggtaaaccagtgtcttattatctacatgtaattgatcgtactaag
ttagaacgttatttccaccgcttaaagaacaataaacaaggtggcgatgaaaattctgat
tctgtgataaataacactgccagcagtagtaataagattacaaatagaagtgagagaggt
gacagagctaaacgagatctttcaagacagttagaaagcccaaatcattcagaacaacaa
ggaacgaatagtgattcagatatagatgagaataatattaaaaatcgtcggcagccaaat
aagattcgtagaaagttaaatagaaaatctaatggtataacaagacctccagctagaggt
agacaaagaggaagaggcgtgaagaaatcgaaacccaaaaaagcaattaatatttctggt
ctggatttattacatagtcaaacattacttagcacatctccacaagctctgggaaagaaa
ccaccgcctgcgcctggttgtgtagatcaacaattgtcttcattatcactttcattacaa
tcacattccacctctgtacacgaagaacttagtataccacctgctccgtccgccactcca
tatgcattacaaatacttttggacttgtacagggaccaattcatgctcatgttagaatca
atgagaactccttcatacagagtatcagtcaatacagatattgcaaaagaaagagaaaga
aattcaaaattgcaatcaagagcggcgcaattagaaaaacaaataaaagtattaattgat
gatagtgtagcacttttaaaagcaagaatgaccgagttaggtataaatgcaacatcacct
ggagatttacttgcaaaagctaaagaaatagttcttagacataaacaattgcaagctaaa
gcaagtaagctgcaagctcaagttgcatctatggaaagtgaacaatcaagattaactgca
cttagacatcaagaattacaagagaaatataacagtcttacaaatacgaatggcatatca
aatccaccacagccacttactcaggattacatattgaaagaaatttccgcaactttgtct
caacgtaaaagattacattgtcaagtgtccaaattggaacatgaattaaatgtgttggaa
agagcaagtagtgaaaaacaggttgctgcaatagctcaacaacaaagagaggcaagttct
aaacattcacaaaatcaacatcatcaacagcaaaatggaaaaagcggatcatcacgaaaa
aatagagaaggacgttctagatcacaagaatggcctgacgttcctgatattggaaaaata
caagaaaataatccagaaatattggcgcaaaaaattttggaaactggcagacaaatagaa
gctggtcgaatattaagacaaaatactaatacaagtaataattctagaactagactgcca
caagcatctctcagtttttctactacatcatccatttcttcctcacaaacacaaataaat
aataaagaaacaacaaatagaactcaggaacctcctagagttgcaaattttgaagataga
ttaaaaagtattattacaagtgttctaaatgaagatcaacaaaatagaaataagcaacaa
caaatgcaactacaggtgcaattacaaaatcagactgagcaagataggaaacgtattaca
ttaccacaaaatgtttctactcctgattatacacaggtttcacctgcaaagttagcactt
cgccgtcacctctctcaagaacgtctttcttctcatttaacaccacctgacagaccaaca
atcgactcgaggcagtcgagtcatgataatcgtattgtaacaggaggaaatggactgctc
ggtactagaacaataggtgatttagtcagtggagaaatagaaagaacattagaaatatca
aatcaatctataataaatgcagctgttgatatgagtgcaatgataaggccggaaactgta
tattctcctattagtagaccagctagtgcagaaggtgatgctggtttatcaactcttgct
catgtagctagttatgctccaacttgttctgcagtttcaacatgcactcctactaccact
tcaagatcatctgtattatttacaccagtaacacaaccacaaagatacacaccagttcaa
ttacctcgtgcagacatcaaaccttatcacgaatcgtatttctctgacaatccttctcaa
tcacttacacagagtcatcctccaccatcattacattcatcacagactacatcaaatgga
gagcttttgccagtagaaggattagctgcatctttacatgctcgtatattaaataatcac
aatactaaaactgaatcaatactgactacaaatagaagatttcaaccatatcctcgatat
gcaactagtagcaacaataatggcagtgcaacaacaaatggtatggtgacagccatttgt
caatcacaatcttcaatgtcagtaaaaacagaggcagttgtgtcatcagtaagcacaagt
ggagcgccattaagtcctcttgtagaaccacattctaatacatctacaccactagttgat
gaacctcaaatgacaacacagagacaacgaaatggtattggcgatgacgatggagaggca
gattggcaagatcgtatcagttctggatttgatagactggttgcgtttgcgtctacagaa
ctagataagcgaagaaggtcgacagagggagtaaatacgagtcctgatagtggtttagga
tctgatagcactgtgacaggacctccaccagtaattccatcaccggacgaagcactagga
cctcctcgtacaccttcaccgactagtcctcgtccacccaatccctccaatggtagtacg
agcagtaacagcagcagtaatagtagcacatcttcggtgcctctaaaatatcaacgtcaa
ctggatccggaacgacatcattttaagaaaaagttttttcatagagattggaataattct
ggtagtaccagtaagtttcgtcctaaaggcaaggattgggattggaatcattcaggacag
tggccttcgaatgacgaacaatcttaa

DBGET integrated database retrieval system