KEGG   Apis mellifera (honey bee): 552235Help
Entry
552235            CDS       T01057                                 

Gene name
E(z)
Definition
(RefSeq) histone-lysine N-methyltransferase E(z)
  KO
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ame  Apis mellifera (honey bee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    552235 (E(z))
Enzymes [BR:ame01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     552235 (E(z))
Chromosome [BR:ame03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     552235 (E(z))
   Polycomb group proteins
    PRC2-EZH2 complex
     552235 (E(z))
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BEEBASE: 
LinkDB All DBs
Position
LG9
AA seq 746 aa AA seqDB search
MSKAKVSAEWKKRVKSEYMRLRQMKRYKRADEVKVAWNQNRKVMSELLMSEQKRWADGKA
MWLAMQDIPPHVSCMKKAEVTSSDNEIQTCPVKIINAVTPIPTMYTWAPIQQNFMVEDET
VLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRESGFMDDSIFVDLVNALMQYEKEDK
DKEQIKKGKDKEDDRIKIEAKSEKLLEEAKTDKNPFPSMHIFNAISSMFPDKGRPEELKE
KYIELTEKSDPNILPPECTPNIDGVNAKSVAREQTMHSFHTLFCRRCFKYDCFLHRLQVC
HPGPNLQKRKGPDLKPFAEPCGTECYMHLEGMKEKLAAQAADIKDEESDEKRGGPRKVRK
QASVDSGNEASSEDSNDSNKYSQGGGCQDFKQNVNKETKSEESMEDQAQPENQAPFTLLG
LDKRIKTESEPSWTGSEQSLFRALHKAFPGNPCALAQIMLTKTCQEVYQFAQKEASDIPA
VENLKDFTPPRKKKKKHRLWSMHCRKIQLKKDSGANHVHNFAPCDHPGRQCDNSCPCIQA
QNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCQTCGADQFQITKIS
CKNVSVQRGLHKHLLMAPSDVAGWGIFLKESAAKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVNGDHRIGIFAKRAIQPGE
ELFFDYRYGPTEQLKFVGIEREMEFL
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagcaaaagtatctgcagaatggaaaaaacgagtgaaatcagaatatatgcgt
ttacgacaaatgaaacgctacaaacgagcagatgaggtaaaagtagcttggaatcaaaat
cgtaaggttatgtctgaacttttaatgtctgaacaaaaaagatgggcagatggaaaagca
atgtggcttgcaatgcaagatataccaccgcatgtatcttgtatgaagaaggctgaagta
actagttccgataacgagatacaaacttgtcctgttaaaattattaatgcagttactcct
ataccaaccatgtatacttgggcaccaatacaacaaaattttatggttgaagatgaaact
gtgctgcataatataccttatatgggagatgaaattttagaccaagatggtacatttatc
gaagaattgataaaaaattatgatggaaaagtacatggagacagagaatcaggtttcatg
gatgattcaatttttgtggatctagtaaatgctttgatgcagtatgaaaaagaagataaa
gataaggaacaaattaaaaagggaaaagataaagaagatgatagaattaaaatagaagct
aaaagtgaaaaattattagaagaagctaaaactgataaaaatccatttccatctatgcac
atatttaatgcaatatcaagtatgtttccagacaaaggtagaccagaagaattgaaagaa
aaatatatagaattaacagaaaaatcagatccaaatattttaccaccagaatgtacacca
aatattgatggagtaaatgcaaagagtgtagctagagaacaaacaatgcattcttttcat
acattattctgcagaagatgctttaaatacgactgttttctccatcgtcttcaagtttgt
catccaggaccaaatttacaaaaacgaaaaggacctgatttaaaaccttttgctgaacca
tgcggaaccgaatgttatatgcatttggaaggaatgaaagaaaaacttgctgcacaagcg
gctgatataaaggatgaagaaagtgatgaaaaacgtggaggacctagaaaagtgcgaaaa
caagcaagtgtagattctggaaatgaagcaagtagcgaagatagcaatgatagtaataag
tatagtcagggaggcggttgtcaagattttaaacaaaatgtcaacaaagaaacaaaatcc
gaagaatctatggaagatcaagcacaaccagaaaatcaagcgccgtttacgcttttgggt
ctcgataaacgaataaaaacagaaagtgaaccatcatggacaggttcagaacaaagtcta
tttcgagctcttcataaggcttttcctggtaatccatgtgcattagcgcagattatgttg
actaaaacatgtcaggaagtatatcaatttgcacaaaaagaagcatcagatattccagca
gtagaaaatttgaaggactttacaccaccacggaagaaaaaaaagaaacatcgtctttgg
tcaatgcattgtagaaaaatacagctaaaaaaagattctggcgccaatcatgtccataat
tttgcaccatgcgatcatccgggaagacaatgcgataactcatgtccatgtatacaagct
caaaacttctgtgagaagttttgccaatgtagtagcgaatgtcaaaatcgttttccaggg
tgtaggtgcaaagcccaatgtaatacgaaacagtgtccttgttacctagctgtaagagaa
tgtgatccagatttatgtcagacatgtggtgcagatcagtttcaaattaccaaaatatct
tgcaaaaacgttagcgttcaacgaggtcttcataaacatcttttaatggcaccatccgat
gtagctggttggggaatatttcttaaagaatctgcagcaaaaaatgaatttatatcggaa
tattgtggtgaaattataagtcaagatgaagctgacagaagaggaaaagtatatgataaa
tatatgtgtagttttctctttaatcttaataatgattttgtcgtggatgctactcgaaaa
ggaaataaaataagatttgccaatcattcaataaatcctaattgttatgcgaaagtaatg
atggtaaatggtgatcatagaataggtatttttgccaaaagagctattcaacctggcgag
gaattattttttgattatagatatggaccaacagaacaattaaaatttgtgggtattgaa
cgtgaaatggaatttttataa

DBGET integrated database retrieval system