KEGG   Apis mellifera (honey bee): 725883Help
Entry
725883            CDS       T01057                                 

Gene name
Ggamma1
Definition
(RefSeq) guanine nucleotide-binding protein subunit gamma-1
Organism
ame  Apis mellifera (honey bee)
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma Methyltrn_RNA_4
Motif
Other DBs
NCBI-GeneID: 725883
NCBI-ProteinID: XP_006561440
BEEBASE: GB12060
LinkDB All DBs
Position
LG16
AA seq 70 aa AA seqDB search
MDMVTTNLQQQRQITEQLRREAALKRITVSKAVEDIMKYITEHEQEDYLLVGFSSQKSNP
FRERSYCTIF
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggatatggtgactacgaatttacaacaacaacgacaaatcacggagcagctacgacgt
gaagctgctttaaaacgaattacggttagcaaagctgtcgaagatatcatgaaatatatc
acagaacacgaacaggaagattatcttttggttggtttttcatcacaaaaatcaaatccc
tttcgtgaaagaagttactgtaccattttttaa

DBGET integrated database retrieval system