KEGG   Apis mellifera (honey bee): 726599Help
Entry
726599            CDS       T01057                                 

Gene name
GB20065
Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     726599 (GB20065)
Peptidases [BR:ame01002]
 Metallo Peptidases
  Family M2
   726599 (GB20065)
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   726599 (GB20065)
CD molecules [BR:ame04090]
 Proteins
  726599 (GB20065)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BEEBASE: 
LinkDB All DBs
Position
LG13
AA seq 817 aa AA seqDB search
MMIVRKLIGILILICSLMQGSFNKYLEGMNVNLGDALQFLREYDNEASAMCTRVITAQWN
FATNVTEENRRRMIEEQSLKLKFDRISWRKAVSFAWSRIGDPFAQRELKMIAIKGRNSLT
DDKFNELHNLILEMKEIYARTRVCPYRTIDANCDLSLDHDVNKAMAKSKNYDELLYYWHA
WHEATGPQLKNKYIRYVQLANQAARLNGFQNAGDQMREFFEEEYFQQNTADVMSAIMHLY
KNLFTYVRTKLFERYGDKVRRDGPLPAHIFGNMWAQNWEELYDLVRPFPASKKLDVTLEM
MIQSFTSLRMFQIAEEFFTSLGMKPMPPEFWRFSLFEKPIDRDVKCSPSAWDFCNRIDYR
IKQCTRVTMEDLLSAHHEIARLQYYLQYRDQPLLFRNEAIPGFFEAVSDAIELSVFTPQH
LSKLELHDNTTDDYGSDINFLMLMALRKIAYMPFAYIVDEWRWYVFNEGVADMTNKWWEL
RLQYQGIVPPVPRSERDFDPGSKYHIPADALYAKYFVGVVLQFQLFESLCEIAGHTGDLH
TCDFYRSREAGRLLSDVLSMGSSKPWKDVVRQMTRGRTNRMDAGAILRYFEPLNQWLKRQ
NEMEPVVGWITNRDDTEKHLHYRNLSCNYVPFFNRIKAYEIPYKNKFSKNILVARYYNLN
ASKRNIPKIEPAKKVTVFAKMKQMTKDYWHVLIPVHIITSIGWMVSFYFIIKNGVDITYV
MELMHFSKKYVEVVKNSDVGNWALAYLLYKIFTPLRYTITIGCTTMAIRQLSKSGIVKPL
SFGKQSHMSAYEIVSESSKTTKTGFKSIERSTEPPKT
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcgtaagaaaattaatcggtatcttgatcttgatttgttctctgatgcaagga
agcttcaacaaatatttagagggtatgaacgtgaatttaggggatgctttgcagtttctt
agagaatatgacaatgaagcttctgccatgtgtacgagagtaataacagcgcaatggaat
tttgcgaccaatgtcactgaagagaatcgtcgaagaatgatagaggaacaatctttgaag
ttgaaatttgatcgaatctcatggagaaaggccgtaagctttgcttggagtcgaatagga
gatcccttcgctcaaagggagctcaaaatgattgctataaaaggacgaaactctttgact
gatgacaaatttaacgagttacacaatcttatattggaaatgaaggaaatatacgcgaga
acacgagtgtgcccttacagaactatagatgcaaattgcgatctgagtttggatcacgat
gtgaacaaggcaatggcaaaatcgaaaaactatgatgaattgttatattattggcatgct
tggcacgaagcaactgggcctcaattgaagaacaaatacataagatatgttcagttagcg
aatcaagccgctagattaaatggatttcagaatgccggtgatcaaatgagagaattcttc
gaagaagaatatttccaacagaacacggcggatgtaatgtcggcgattatgcatttgtac
aaaaatctgttcacttatgtgaggacaaaattattcgaaagatacggggacaaagtgaga
agggatggaccacttccggcgcacatctttgggaacatgtgggcgcaaaattgggaagaa
ctttacgatctggtgcgaccgtttccggcaagtaagaagcttgacgtcactttggagatg
atgattcaaagtttcacgtctttaaggatgttccaaatagcagaggaattttttacttca
ctcggtatgaagccgatgcctcctgaattctggagattctccttgtttgagaaacctatc
gacagagacgtaaagtgttctcccagcgcttgggatttttgcaatagaatcgattacagg
ataaagcaatgtacgagagtcacgatggaagatttactgtcggctcatcacgaaatcgct
cgattacaatattatttgcagtatcgggatcaaccattattatttaggaacgaagcaatt
ccaggattcttcgaggcagtcagcgatgcaatcgaactctcagtgttcacgcctcaacat
ttaagtaaactcgaattacatgacaataccacggatgattatggaagcgatatcaatttc
ttaatgctaatggcgctacgtaaaattgcctacatgccatttgcttacatagtcgacgag
tggagatggtatgtgttcaacgagggtgttgcggatatgacgaacaaatggtgggagtta
aggttacaatatcaaggaattgttccgccagtgccacgatcggaaagagatttcgatcct
ggctcaaagtatcatataccagctgatgctctttacgccaaatattttgttggtgttgtt
ttacaatttcaattgttcgaatctttgtgtgaaatagcaggccacactggtgatctacat
acctgtgatttttacagatcacgagaagctggaagattattatccgatgtattatcgatg
ggttcatctaaaccttggaaagatgttgtacgtcaaatgacaaggggaagaacaaacaga
atggatgctggagctatattgagatatttcgagcccttaaatcaatggttgaaacgacaa
aatgaaatggaaccggttgtcggatggattacaaatcgcgacgatacagaaaagcatcta
cattatagaaatttgtcatgcaattatgtcccgtttttcaatcgtattaaggcgtatgaa
ataccgtataagaataaatttagtaagaatattctggtggcgcgatattataacttaaac
gctagtaaaaggaatatcccgaagatagaaccggcaaaaaaagtaacagtgtttgcgaaa
atgaaacaaatgacgaaggactattggcatgttttaataccagttcatataattacttct
ataggttggatggtctcgttctattttataattaaaaatggtgtggatattacatacgtt
atggaacttatgcattttagtaagaaatatgtagaagtggtaaaaaactcagatgttgga
aattgggcattagcgtatcttctttataaaatattcacacctcttagatataccatcact
ataggatgtacaacaatggcaattagacaacttagcaaatcgggaattgtaaaacctctg
tcatttggtaaacaatcacatatgtctgcatatgaaattgtgtcagaatcaagtaaaacg
acaaaaacaggattcaaatcgatagaacgaagtacggaacctccgaaaacgtaa

DBGET integrated database retrieval system