KEGG   Astyanax mexicanus (Mexican tetra): 103022779Help
Entry
103022779         CDS       T05042                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASH1L-like
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103022779
Enzymes [BR:amex01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103022779
Chromosome [BR:amex03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103022779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
23
AA seq 2955 aa AA seqDB search
MDQRTQGGPTTPPPLPANALPVEREKEGVGGQKEDEEDKRKREKDRDGVPANLCNPENGP
GDPQQQSPQFSVKETSYSEGNVKLKIGLQAKRMKKPPKILENYVCRPAFRATVRHGTRGG
GRGNRRGGSNDGSGNTPSPTHVKEAEKGPTVNQGAPQSSGVPAATAFASSLPPPTSTSTS
PPVNGSASAKRGPPKLACKSEGKADVKSIAPSERPLNLHGSLADSKSHSSGKKGLVSQSN
PSAPSPPAPSPTSSTTQDTKMDGVSKSPEYSYTDNQKEQERGVQSWGAPTVTEKLAQLIA
TCPPTKCPKPKPRKVSPASLNSSSPPLVTNLQRPERNRNTYSRAVHLAPPPPVSRPPGRP
YGSRNKDSILEKLSSIPRKEDADGLSKGIIGSNSPTSVPAVSYGNSRFTNITNDSNDNNN
SSVLKSQSRLGHCPSYSSTPTLSTSTSSLERLGSGSSHQGTPASTGSRIRASPSQTEENM
EREKEWDKDTDNPRDLSKSPSATVSGKQDTKEKLPVSVPRGDRGKSSSPAKRSPAQESRT
AGESSPIESTKHQTASHSNTSSISSSSSPAALCDDPASPGSPASPAEQDSKPLKKRRGRR
PRWTKAVSRAHRPLQDTVSCQSKPTTPLDSDFTSLQTMRRPVGRPPNANRVPSVVSQLFE
SQPKKRGRPKSKMPRLDAPARGRPPLKAAPSKVYSMLKSKEEQDPPVLHPEVDLNPPKPM
PRKRGRPKRLPPTLPQETQPPTLAPESGDAESGDKGFRNKGNGQLIMKTIIGKINKMKTV
KRKRFLSQILLGPGSGPDPEVPKSTVPSGTATTTTQSLSSLAATFGGKLGPQINVSKKGT
IYMGKRRGRKPKMPSNPLPGAPTPPPEPFLSPNTSSPHHSHQASQGSQNQQHQVPPSDIF
PSPSLSQSSGGQSPISDASFVEPGSVHFMTHPHCSHSHQNHHPFSFTPPTFSAPSPRTLG
GTTSAHSSQKKPSCRGHHHHHHHYRQHYHYHKLSPPRPLLPTSPAPLSELKEATPSPVSE
SHSEETVPSDSGIGTDNNSTSDRGEKGGSASGLTGVGVPQGLTSGLLIPGLMGSSVGAGV
GLNPRASRRHSSSGLLDRPSPTPSPLGTRSSPDPRRTHPVAPPSALVGHKEKHKHKCKRR
GHGCPGYDKLKRQKRKRKKKYLQLRSRRQDPDFLAELDEICVQLSEIRISHRTPALRLGS
SLGLGAGPAGVNRGAGLASARAGSSIGSGTNPPPHHYLHRDLLPTIFRINFSGYYSPHPA
YPCDSLHYVRKPDLKKKRGRPPKLRESMSEVPFVPGLGFPLSSGGFYHPSYGVPYSSAPL
GLGYYRGYPPASALYPHPHHQAPHSSQSHHGHHSPSFPPPPSYVHHHHPSHLLLNPSKFH
KKKHKLLRQEYIGGGRSPVLYPAMSSELSFGWHHKHKHRHKHRDRCGEEEGDDGAGTGGG
GGGGGRSGGESLGTGRGERGRRGGSLESLQRCGYGRDGSADSSANKQAAATSGNSPSSSS
SSSAERYKRKEASVSCLGPSRLSLGRGSRGHHPADSWFRIGSSDVDYSKLSRNQVLNQGA
FSDGHVQDSIGCSDSEEEDPTSANEEEDSGSHHTNLFASALTRNSLKGNRGRKGGSSEGS
GLIRLDKSLRKDRSTSAERRESGNCSAQTRGGHSGMPECSEAPLHRHHHHPALPLSHALS
CLPHLSLEQPGGGMAPRPSSRQTSPSTRPSQPACCLDSSPSHLSHRSAPPPHKNNLHHVN
KILRAKKLQRQARTGNNVVKKRGPGRPRKHPLPSPPPSPPPSVPELENHSSLAKHRASWE
GDTVIDAIESVVQGQKRKSRKRKQWERERDENEEDEEEVEDDREEEDEEEETRGPETREE
EVVAARARPTGGTGWLTQEQCFQSAVEGKSDGHSSPECTGPAPEEQPPPTPIPNPREKRA
ARPPKKKFQKAGLYSDVYKTDDPRSQLLQLKKEKLEYIPGEHEYGLLPAPIHVGKYLRQK
RIDFQLPYDILWLWKHDQLYKRPDVPLYKKIRSNVYVDVKPLSGYEATTCNCRLPEDHSD
KGCLDDCLNRMIFAECSPSTCPCGEECDNQRIQRHEWVQCLERFRTDGKGWGIRTKEPLR
SGQFIIEYLGEVVSEQEFRSRMMEQYFAHSGQYCLNLDSGMVIDSYRMGNEARFINHSCE
PNCEMQKWSVNGVYRIGLFALKDMDNGTELTYDYNFHSFNTEEQQVCKCGSEGCRGIIGG
KSQRINGLPGKAGGSGGGAKRLGRLKEKRKSKHHLKKREEESSDSSKFYQHLLMKPMSNR
ERNFVLKHRVFLLRNWEKMREKQELLKREGERERERESTSLSPYARWGSVIRDDGNIKSD
VFLTQFSALQTSRSVRTRRLAAAEENTEVTRTARLAHIFKEICDMITSYKDSAGQTLAAP
LLNLPSRKRNMQYYEKVSDPLDLSTIEKQILTGHYKTVEAFDADMLKVFRNAEKYYGRKS
PVGRDVCRLRKAYYGARHEAAVQIDEIVGETASEADSSDSLERDQAHHHHHHGPGSHDKD
DDVIRCICGMYKDEGLMIQCEKCMVWQHCDCMRLEAEVEHYLCEQCDPRPVDREVPMVPQ
PSYAQSGSIYYICLLRDELLLHQGDCVYLMRDSRRTLEGQPVRQSYRLLSHVNRDKLDIF
RIEKLWKNEKGERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCCVL
DLYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFNHFPKRLAPKR
DFSPHYVPDNYKRNGGRAAWKSERSKGSVACDEESSPSVSCDQLPVAFSRDTEGSGGRRA
EGEVDRAHEDSSTPMTSLVPPQERTRSAEEEDEDDEEEVDEEEERREMDEGTVERGGGME
VLEPHTSLSLSPSPLHHPVLGRREAQRDRLNKILLHLLHRAPSKNAIDVTYLLEEGSGRR
LRRRTLGLSDFVIRK
NT seq 8868 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaggacacagggggggcccaccacgccaccccctctccctgcaaatgctctg
ccggtggagcgtgagaaggagggagtaggtggccagaaagaggatgaggaggacaagaga
aagcgagagaaggacagggatggggtgccagccaacctttgcaaccctgagaatggccct
ggtgacccgcagcaacagtctccacagttctctgtcaaggaaaccagctattcagagggc
aatgtcaagcttaagataggcctgcaggctaaacgaatgaagaaaccccctaaaatccta
gagaactatgtatgccgaccagcttttcgagcaactgttcgacacgggacccgaggaggg
gggcgtggaaatcgtcggggaggatcaaatgatggtagtggcaacactcctagtccaacc
catgttaaagaagcagaaaagggccccaccgttaaccaaggagcgccacagtcctcaggt
gttcctgctgctactgccttcgcatcttctcttcctcctcccacttccaccagcacttcc
cctcctgtgaatgggagtgcatcagctaaacgaggtcctccaaagctggcctgcaaatca
gaaggaaaggcagatgtgaaaagtattgcaccttcagagagaccccttaatttgcacggt
tctttagcagacagcaaatcacactcctctggaaagaagggcctagtgtcccagtctaac
ccttcagccccttctccaccggctccttcccccacttcatcaaccacacaagacaccaag
atggatggagtttcaaagagccctgagtactcatacaccgataatcagaaggaacaagag
agaggagttcaaagctggggagcacctacagtcacagaaaaacttgcgcagctcatagcc
acctgcccacctacaaagtgtcctaagcctaaaccccgcaaagtgtccccagcatcatta
aatagtagttctcctcccttggttaccaatttgcagcgacctgagagaaataggaacact
tattccagagcagttcaccttgctcctcctccccctgtttctcggcctccaggccgcccg
tatggttctagaaacaaagacagtatcctggagaagctatcaagcataccaagaaaagag
gatgctgatggactttcaaaggggattataggtagcaacagtcccacctctgttccagct
gtatcatatggtaacagccgctttacaaacattacaaatgatagcaacgacaacaataac
agcagtgtattgaaatcacagtctcgtcttgggcactgcccttcttattcctccacacct
actctctccacctccacatcctctttagagaggttagggagtgggagcagccaccaggga
acacctgcctcaactggctctcgaattagagcgagcccctcacaaacagaagagaacatg
gagagagagaaagaatgggacaaagacactgataatcctagagacttaagcaaaagtcct
tcagcaacagtatcagggaaacaagacactaaagagaagctgcctgtgtccgtacctcga
ggtgatcggggaaagagctcaagtccagccaagcgaagtcctgctcaggaaagtcgcact
gctggagaatcaagccctattgaatccaccaaacaccaaactgcgtctcattctaacact
tccagtataagcagcagcagcagcccagcagcactttgtgatgatcctgcatctcctgga
tctcctgcctcaccagcagaacaggactcaaagcccctgaaaaaacgcagaggtcgtagg
cctcgctggacgaaggcggtcagtcgtgcacacaggccgttgcaagacacagtttcttgt
cagtctaaacccaccacaccactggattcagattttacttctttacaaacaatgcgacgg
cctgtgggaaggccgcccaatgctaatcgtgtaccatctgttgtctcccaactctttgaa
tctcaacccaagaaaaggggccgccctaagtccaaaatgccaaggcttgatgcacctgca
cgtggtcgaccacctctcaaggcagccccctcaaaagtctactccatgcttaagtccaaa
gaggaacaggatccccctgtcttgcacccagaggtggatctgaaccctcctaaacccatg
ccaaggaaacgagggagaccgaagcgcttgccaccaactctaccacaggagacccagcca
ccaacactagctccagagtcaggggatgctgaatcaggtgacaagggctttcgcaacaag
ggcaatgggcagcttataatgaagacaattattggcaagataaacaagatgaagacagtt
aagcggaagcggttccttagtcagatccttttaggaccaggctcgggacctgatccagaa
gttcctaaaagcacagttccctcaggaactgcaactactacaacacagtctctctcatca
cttgctgcaacctttggtggaaaactgggacctcagatcaatgtaagcaaaaaggggaca
atatacatgggtaaaaggaggggccgtaaaccaaaaatgccaagcaacccattaccaggt
gctcctacgccaccacctgaacctttcttgtccccaaacacctcctcccctcatcactct
catcaggcatctcaaggttcacaaaaccagcagcatcaggtgcctccttctgatattttc
ccctccccatcgctttcccagtccagtggtggccaaagccccattagtgatgctagcttt
gttgaaccaggttcagtgcatttcatgacccatccacactgcagccactcccatcaaaac
caccacccattttcttttaccccaccaacgttttcagcaccctctcctcgtacacttgga
ggaaccacatctgcacactcctcacaaaagaagccttcttgcagaggccatcaccatcat
caccaccactaccggcagcactaccattatcataagctctcgcctcccaggccgctattg
cccacatcccctgctccccttagtgaattgaaggaagctacaccttcacctgttagtgag
tcacacagtgaggaaactgtgcctagtgacagtggcattggaacagataacaacagcaca
tcagatcgtggcgagaaaggtgggagtgccagtggcttaactggagttggggttccacag
ggtttgactagtggactactaatacctggcttaatggggtcatcagtaggtgctggtgta
ggacttaaccccagagccagtaggaggcattcgtcatcagggcttcttgatcgcccctca
cccacaccatcaccacttggaacaaggtcatcacctgacccgcggcgaacacacccagtg
gctcctccctcagcactagttggccacaaagagaagcacaagcataaatgcaaacgacgt
ggacatggctgcccaggttatgacaagctgaaaaggcaaaaacgcaaacgcaagaagaag
tacctgcagctgcgttcacggagacaggatcctgacttcctggctgagctggatgagatt
tgtgtgcagcttagtgaaatacgaatttcccaccgcacacccgcccttcgtttgggcagt
agcttgggtctgggagccggtccagctggcgtaaaccgtggggctggcttggctagtgcc
agagcaggcagtagcattggaagtggaaccaaccccccacctcatcattatttgcataga
gaccttttacccactatcttccggatcaactttagtggttactattccccccacccagcc
tacccatgtgattctctgcactatgttcgtaagcctgatctcaagaaaaaacgtggaagg
cccccaaagctacgggagtcaatgtcagaggtgccttttgttcctgggcttgggttcccc
ctctctagcggagggttctatcacccatcttatggtgttccatattcctctgcccctctt
ggacttggctattaccggggttatcccccagccagtgcactataccctcacccccatcat
caggctccacattcgagccagtcgcatcatggacatcattcgccttcctttcctcctcct
ccttcatatgttcatcatcatcacccatctcacctgcttcttaacccttccaagttccac
aaaaagaagcataagctgctaagacaggagtatattggtgggggtcgttcaccagtgctt
tatcctgctatgtcctctgaattgtcattcggctggcatcacaagcacaagcacaggcat
aagcatcgtgaccgttgtggagaggaagagggtgatgatggtgcaggtacaggaggtgga
ggaggtggaggagggagaagtggaggtgagagcttggggacaggacgaggtgagcgaggg
agaagaggagggagcctagaatctcttcagcgttgtggatatggtcgggatggctcggct
gactccagcgctaacaaacaggcagctgccacctctggcaactccccctcgtcttcatcg
tcatcctcagcggaaagatacaaacgcaaagaagcctctgtgtcttgtctaggcccttca
cggctatctttgggacgagggagtaggggacatcaccctgcagactcctggttcaggatt
ggcagctctgatgttgattactccaagctctcacgtaaccaggttctcaaccagggtgcg
ttctctgatggacatgtgcaagactcaatagggtgctcagatagtgaggaggaagatcct
acttcagctaacgaagaagaggattcaggatcccaccacacaaacctgtttgcgtctgct
cttactcggaactctcttaagggtaatcggggcaggaaaggtgggagctctgaaggctcc
ggtctgatacgattggataaatctctgaggaaggatcgttccacgtctgctgagaggaga
gagtctggaaactgtagtgctcagacacgtgggggccattcaggtatgcctgagtgttca
gaggctcctctccatcgtcaccatcaccaccctgccctgcccctctcccacgccctctca
tgtctcccccacctcagcctggaacagcctggcggtggcatggcaccccgcccctccagc
cgtcaaacgagtccatctacacgcccctcccaacctgcatgctgccttgactcttccccc
tcacacctctcccaccgctcagctccgcctcctcacaagaacaacctgcatcatgtcaac
aagatactgcgtgccaagaagctgcagcgacaggcacgcaccggcaacaacgtggtgaag
aaaaggggtccggggcggccccgcaaacacccgctaccttctcctccaccatctcccccg
ccttcagtccctgaactagagaaccactcttctctcgcaaagcacagagcgagctgggaa
ggagacacggtcattgatgccatcgagtctgttgtacagggtcaaaaacgaaagagccgg
aagaggaagcagtgggagagagaaagagatgaaaacgaagaggatgaggaagaggttgaa
gacgatagggaggaggaagatgaggaagaggagacaagagggcctgagaccagagaggaa
gaggtggtagctgcaagagcacgaccgacaggtgggacgggatggctgacgcaagagcag
tgtttccagagtgccgtggagggtaaatctgatggccactcctcccctgaatgtacaggt
ccagcccctgaagaacaacctccccctacaccaattcctaatccgcgggaaaaaagagct
gctagaccacctaaaaagaagttccagaaggcggggctttattcagatgtgtataaaact
gatgatcctcgaagtcagctgctacaattaaaaaaggagaaattggaatatattccaggt
gaacacgagtatggccttcttcctgctcccattcatgttgggaagtacttgagacagaag
cgcattgatttccagttgccttacgacatcctgtggctttggaaacatgaccagctctat
aagagaccggatgtgcctctttacaagaaaattcgatccaatgtatatgtggatgtgaaa
cctctttctggctatgaagccactacctgtaactgcaggctcccagaggaccacagtgat
aagggctgcttggatgattgcctgaacaggatgatctttgctgagtgttctcctagcact
tgtccgtgtggtgaggaatgtgataaccagcgtattcaaaggcatgagtgggtgcagtgt
ctggagcgcttccgaacagacgggaagggctggggcatccgaacaaaggagccactccgt
tctggacagttcatcattgaatacttaggcgaagtggtcagtgagcaggagttcaggagt
cggatgatggagcagtacttcgctcacagtggccagtactgtttaaacctagacagtggc
atggtgattgacagctatcgcatgggcaatgaggctcgcttcatcaatcacagctgtgag
cccaactgtgagatgcagaagtggtcggtgaatggggtgtacaggattggtctgtttgct
ctgaaagatatggacaatgggacagagttaacctacgactacaatttccactctttcaac
actgaagaacagcaagtctgtaagtgtggctctgaaggttgccggggtatcattggtggc
aaaagtcaacgaatcaatggcctccctggcaaagcaggagggtcaggaggcggagccaag
aggcttggcagattaaaagagaaacggaaatcaaaacaccatctaaaaaaacgggaggag
gagtcaagtgacagcagtaaattttaccagcatcttttgatgaagcccatgtctaacaga
gagaggaactttgtgctgaagcaccgggtgtttctactgcgaaactgggagaaaatgagg
gagaagcaggagctgctaaagagggagggagaaagggagcgagagagggaaagtaccagc
ctctccccttacgcacgctggggaagcgtcatccgggacgacggaaacatcaagtcagac
gtgttcctgacgcagttctctgcgcttcagacctctcgttccgtgcgaacgcgcagactt
gccgctgcagaagagaatacagaagtcacccgcacagcacgactcgcacacatctttaaa
gagatctgtgacatgatcaccagctacaaagattcagctggacagacccttgctgctccc
ctgcttaatttgccttctagaaagaggaacatgcagtactatgagaaagtgtccgaccct
ctggaccttagtaccatagagaagcagatcctcaccggacattacaaaaccgtggaggcc
tttgatgcagacatgcttaaagtattccgcaatgctgagaaatactatggccgcaagtcg
ccggtgggtcgggatgtgtgcaggctgcggaaggcttactatggcgctcggcatgaggcc
gctgtccaaattgacgagattgtgggtgagacggccagcgaggcggacagctccgattct
ttggagcgcgaccaggcacaccaccatcaccaccatgggcctggtagccacgacaaggac
gacgatgtcatccgctgcatctgtggcatgtacaaggacgaaggcctaatgatccagtgt
gagaaatgcatggtctggcagcattgtgactgcatgcgtctggaggcggaggtggagcat
tatctttgtgagcagtgtgatcctcgcccagtggatagggaggtccccatggtgcctcag
cccagttacgcccagtcaggctccatctactatatatgtctgctccgagatgagctgctg
ctacaccaaggtgactgtgtttacctgatgagggacagcagacgcactctagagggccag
cctgtgcgtcagtcctaccgtcttctgtcccatgtcaacagagacaaactggacatcttc
cgcattgagaagctctggaaaaatgaaaagggtgaaagatttgcctttggtcatcattac
ttccgccctcatgagactcaccattcgccctcgcgccgcttctaccataatgagctgttc
cgagtgcctctctatgagataattcctctggaagcggtggtgggcacatgctgcgttctg
gacctgtacacctactgcaaaggtcggccgaaaggtgtgaaagagcaggacgtgtacatc
tgtgattaccggctggacaagtctgctcaccttttctacaagatccaccgcaaccgctac
ccagtctgcactaaaccgtacgccttcaaccacttccctaaaaggcttgcacccaagagg
gacttttcgcctcactatgtgccagataattacaagaggaatggcggccgggcagcctgg
aagagcgagcgatccaaagggtctgtggcctgcgacgaagaatcctcccccagcgtgtca
tgtgaccagctgcccgtggccttctccagagacacggaaggaagtggaggaagaagagca
gaaggagaagtggaccgagcgcatgaggactcctccaccccaatgacttcgctagtgcca
ccacaggagcgcacgagatctgctgaagaggaggatgaggacgatgaagaagaggtagac
gaggaagaggagagaagggagatggatgagggcaccgtggagaggggaggaggcatggaa
gtgttggagccccacacctctttgtctctctctccatcacccctgcaccaccctgtttta
ggaagaagggaggcacagagggaccgactgaataagatcctgctgcacctgctccatcgg
gcacccagcaaaaatgcgatagacgtgacttatcttttggaggagggctccggacggcgg
ctgcgcagacgaacgcttggactgagcgactttgtgattaggaagtga

DBGET integrated database retrieval system