KEGG   Astyanax mexicanus (Mexican tetra): 103027950Help
Entry
103027950         CDS       T05042                                 

Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    103027950
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103027950
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103027950
   00430 Taurine and hypotaurine metabolism
    103027950
Enzymes [BR:amex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103027950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
19
AA seq 597 aa AA seqDB search
MAAWAPSSSAGEPDPNTANLRPPSSSYDWSGVAHGCTRKLGMKICGFLQKNNNLDEKSRI
VGAFTEQPSSKNLLTRDNERESHFRHTETDFSNLYARDLLPAKNGEEPTIQFLLELVDIL
TNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGH
PRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGWPNGEG
DGIFSPGGAISNMYSVMIARYKHFPEVKTKGMTAAPRLVLFTSEHSHYSIKKASAALGFG
TENLILLSTDERGRVIPADLEAKVIDAKKRGCVPLFVNATAGSTVYGAFDPINEIADICE
KYNMWLHVDGAWGGGLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVREKGLL
QGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEKHIDRCL
ELSEYLYNKIKNREGYVMVFQGQPQHTNVCFWYLPPNLRGMPEGDEKRQRLHKVAPKIKA
MMMECGTTMVGYQPQGDKVNFFRMVISNPAATRSDIDFLIDEIERLGPGFIKSAQTF
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtgggcaccttcctcctccgccggcgagccagatcccaacacggctaattta
cgaccaccttcctcaagctatgactggagcggagtcgcacacgggtgtacgagaaaactg
gggatgaagatctgtggatttttacagaagaataataatctggacgagaagagtcggatt
gtaggcgcttttaccgagcaaccatcttcaaaaaacctgttaacccgggacaacgagaga
gagtcccacttcagacacacagaaacggacttctccaacctgtacgctagagatttactg
cctgccaaaaatggagaagagcctactatccagttcctgctggagctggtggatatcctc
acaaactatgtgcgcaagacatttgacagatccaccaaagtgctggatttccaccaccca
caccagctgctggagggtatggagggcttcaacctggagctttcagaccagccagagagc
ctggagcagatcctggtggactgtagagacacactcaaatacggcgtgaggacaggtcac
ccaaggttttttaaccagttgtcgaccggactggacatcattggcctggctggcgagtgg
ctcacctcgactgcaaacactaatatgttcacgtatgaaatcgctccagtgtttgtgcta
atggaacagctgactttgaagaagatgagggagatagttggatggcctaatggagaagga
gatggcatattttctccaggaggagcaatctccaacatgtacagtgtgatgatagctcgg
tataagcacttccctgaggtgaagactaaaggcatgacagcagctcctagactcgtgctc
ttcacttctgaacatagccactactccataaagaaagccagtgcagctcttgggtttggc
acagaaaacctgattttgctgagtacagatgagagaggtagagtcattcctgctgatctg
gaggccaaggtcattgatgccaaaaagagggggtgtgttccgctcttcgtgaacgccaca
gctggctccacggtctacggagctttcgaccccatcaatgagattgcagacatctgtgag
aaatacaacatgtggctccatgtggacggagcctggggaggtggactactgatgtccaga
aagcacagacacaagctgaatggcgtcgagagggcaaactctgtcacgtggaatcctcac
aagatgatgggcgttccattacagtgctctgccattctggtccgagagaaggggcttctg
cagggctgcaattctatgtgtgccggctacctgttccagcctgataaacagtacgatgtc
acctacgatactggcgacaaggccatacagtgcggcagacacgtggacatcttcaagttc
tggctcatgtggaaggcaaagggtaccattggatttgagaagcatatagaccggtgtttg
gagctttctgaatatctctacaataaaatcaagaatagagaaggctatgtcatggttttc
cagggacagcctcagcacactaatgtgtgcttctggtaccttcccccaaacttacgtggc
atgccagagggagacgagaagagacagaggctccataaggtggcccccaaaatcaaggca
atgatgatggagtgcggaacaacaatggtgggctaccagccacaaggagataaagtcaac
ttcttcaggatggtcatttcaaacccggccgccaccaggtcagacatcgacttcctgatc
gatgagatcgaaagactggggccaggatttataaagagcgcacagaccttttag

DBGET integrated database retrieval system