KEGG   Astyanax mexicanus (Mexican tetra): 103032345Help
Entry
103032345         CDS       T05042                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: prostaglandin G/H synthase 2
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
Arachidonic acid metabolism
Metabolic pathways
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    103032345
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    103032345
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103032345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
1
AA seq 692 aa AA seqDB search
MCVSVNTDSVGEDTRGLACDVVVSCRHTRNLSELITSPLTFPLLMSIKEREREGEKTVNL
TKITLHPADTALQPDTKDQRSDSRHQRGMNQTVCIFSLLLITLQIFSCSGLDPCCAQPCQ
NSGLCVSKGSDSYECDCTRTGYYGENCTTPELSTRIRSILKPSPNTVHHFLTHYKWMWNI
INNISFLRDAIMRYVLTSRANLVDSPPTYNAAYGYKNWEAYSNLSYYTRTLPPVPTHCPA
TPTLPDAKQVVEKVLLRRKFIPDPQGTSLMFAFFAQHFTHQFFKSDLKKGPAFTRSLGHG
VDLSHIYGESLERQHKLRLFKDGKLKFQVVDGEVYPPLVKDVQVEMHYPPHIPEVHRFAV
GHEAFGLVPGLMMYATIWLREHNRVCDIMKEEHPDWDDERIFQTTRLILIGETIKIVIED
YVQHLSGYHFKLKFDPELLFSQRFQYQNRIASEFNTLYHWHPLMPDTFHIQQQVYAYPQF
FFNNSIVTQHGIGNLVDAFTKQTAGRISGGWNLPPPVQGMAAKVLEHSRQMRYQSFNAYR
KRFGLRPYTSFEDMTGDKELAAELEKLYGDVELVELYSGLLVEKPRPGAVFGETMVEMGA
PFSLKGLLGNPICSPEYWMPSTFGGTVGFDIVNSASLKNLVCLNVKGPCPMVSFKVPDVQ
FPSVSSRNSSSDPSGHSEISPTVLLKERTSEL
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgttagtgtaaacacagacagtgtgggggaggatacaagggggctggcctgtgac
gtcgtggtctcctgtcgacataccagaaatttgagcgagcttattacgtcaccacttact
ttccctcttctcatgagtataaaagagagagagcgagagggagagaaaacagtgaacctc
acaaagatcacactccacccagcagatacagctcttcagccagacaccaaagatcagaga
tcagactccagacatcagagaggaatgaaccagaccgtctgcatcttctcgctcctgctg
ataaccctgcagatcttctcctgctccggcttggacccctgctgtgctcagccatgccag
aacagcggactgtgtgtgtccaaaggttcagactcgtatgagtgtgactgcaccagaaca
gggtactatggagaaaactgcaccacccctgaactttccacgaggatcaggtccatcctg
aagcccagtccaaacacagtgcatcacttcctgacgcactacaaatggatgtggaacatc
atcaacaacatctcctttctgagggacgctatcatgcgctatgtgctcacatcgagggca
aatttggtcgacagcccaccaacgtacaacgccgcctacggctacaaaaactgggaggcc
tactccaacctgtcctactacacccgcactctgcccccagtgcccacgcactgcccggca
actccgacccttccagatgccaagcaggtggtggagaaggttctcctgaggagaaaattc
attccggatccacagggaacgagcctgatgttcgctttcttcgcccagcatttcacgcac
cagttcttcaaatccgacctaaagaaaggacccgccttcaccagatctctgggtcatgga
gtggatctgagtcatatttatggagaatctctggaaaggcagcacaaactgaggcttttt
aaagatggaaagctgaaatttcaggttgtggatggcgaggtgtatccaccgctggttaaa
gacgttcaggtggagatgcattaccctcctcacatccctgaggtgcaccgattcgctgtg
ggtcacgaggccttcggtctggtccctggcctgatgatgtacgccaccatctggctgagg
gaacacaaccgtgtttgtgacatcatgaaggaggagcatcccgactgggacgatgagcgc
atcttccagaccacacggcttattctgattggcgagaccattaaaatcgtgatcgaggat
tacgtccagcacctgagtggataccacttcaagctgaagtttgacccggagctgctcttc
agccagaggttccagtaccagaaccggatcgcctccgagttcaacacgctgtaccactgg
cacccgctgatgcccgacaccttccacatccagcagcaggtctacgcctacccccagttc
ttcttcaacaactccattgtaacccagcacggcatcggcaacctggtggacgccttcacc
aagcaaacagcaggcaggatttctggtggatggaatctgcctcctccagtgcagggaatg
gcggcaaaggttctggagcacagcagacagatgcgctatcagtcttttaatgcatacagg
aaacgcttcggtttaaggccctacacttccttcgaagacatgacaggagataaggagctg
gcggcggagctggagaagctgtatggagatgtggagctggtggagctgtactctgggctg
ctggtggagaagcccaggcctggggctgtgttcggagagaccatggtggagatgggagct
cccttctccctgaaaggcctgctgggaaaccccatctgctcccctgagtactggatgccc
agcacgttcggtggcacggtggggttcgatatagtgaacagcgcctcgctgaagaatctg
gtgtgcctcaatgttaaaggaccatgccctatggtgtccttcaaagtgcctgacgtacag
tttcccagtgtgtccagcagaaactccagctcggacccatccggacacagcgagatcagt
cccacagttttactgaaagaacggacttctgagctgtaa

DBGET integrated database retrieval system