KEGG   Astyanax mexicanus (Mexican tetra): 103032768Help
Entry
103032768         CDS       T05042                                 

Gene name
gsto1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103032768 (gsto1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103032768 (gsto1)
   00982 Drug metabolism - cytochrome P450
    103032768 (gsto1)
   00983 Drug metabolism - other enzymes
    103032768 (gsto1)
Enzymes [BR:amex01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103032768 (gsto1)
Transporters [BR:amex02000]
 Other Transporters
  Pores ion channels [TC:1]
   103032768 (gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
25
AA seq 240 aa AA seqDB search
MAATQKCYAKGSCAPGPVPEGHLRIYSMRFCPFAQRTRLVLQAKGINFETVNIDLKEKPE
WYLEKNPQGLVPTLELPNGKVIYESPITCEYLDEVYPGKKLMSSDPFEKAQQKMLLEDFS
KIVPLFYRIPGTKSKGEDISALETELKEKLSKLNKVLVNKKTKYFGGDSVSMIDYLIWPW
FERVEAWQLKQYLDGTAELKNWTLRMQEDPTVKAIMFKPEDHKVFFDSFMAGKPNYDYGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgactcagaaatgctacgctaaagggagctgtgctcctggtccagtcccagag
ggccatttaaggatctatagcatgagattctgcccttttgcccagagaacaagactagtg
ctccaggccaagggtattaattttgaaacagtgaacattgatctgaaagaaaagccggag
tggtacctggagaagaaccctcagggtttggtgccaacattggagttgcccaatgggaag
gttatctatgaatctccaatcacatgtgaatacctggatgaagtgtatcctgggaagaaa
ttgatgtcctctgacccatttgaaaaagcccagcagaaaatgctgctggaggatttctca
aagattgttccattgttctacaggattcctgggaccaagagtaaaggtgaggatatatct
gcactggaaacagagctgaaggagaaactctccaagctgaataaggttctggtgaacaag
aaaaccaaatacttcggcggtgactcagtgtcaatgattgattacttgatctggccgtgg
tttgagagggtcgaggcgtggcagctgaagcagtatttggacggcactgcagagcttaag
aactggactttgcgtatgcaagaggatccaactgtgaaggccatcatgtttaagccagaa
gaccacaaagtcttttttgactcatttatggctggaaaaccaaattatgactatggtcta
tag

DBGET integrated database retrieval system