KEGG   Astyanax mexicanus (Mexican tetra): 103035459Help
Entry
103035459         CDS       T05042                                 

Gene name
pcsk1
Definition
(RefSeq) LOW QUALITY PROTEIN: neuroendocrine convertase 1
  KO
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     103035459 (pcsk1)
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S8: subtilisin family
   103035459 (pcsk1)
Chaperones and folding catalysts [BR:amex03110]
 Intramolecular chaperones
  Subtilisin family
   103035459 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
14
AA seq 754 aa AA seqDB search
MAVRCPAAVFLGALAVLCALSSPGVNALDRQYLNEWAVEIPGGTDAAQSIANELGYELVR
QIGALQNHYLFKHQSHPSRTKRSADHITKRLSEDDRVSWAEQQYEKQRSKRAPLGADCKE
CSVDKLFDDPMWNQQWYLQDTRTSPSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNH
TDIYPNYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSK
VGGIRMLDGIVTDAIEASSIGFNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQK
GRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATA
YSSGDYTDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHIVVWT
SEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCIVRDDSF
QPRPLKAAGEISIEIPTKACAGQTNSIESLEHVQVEASIEYTRRGDLHITLTSPSGTTTV
LLAERERDTSSNGFRNWDFMSVHTWGENPTGTWTLKITDTSGRMENEGQILSWKLILHGT
SEKPEHMKKPRVYTPYNAVQNDRRGVEHMEDMLEEATAPSQKMVKSRPPAPIAASSPAPE
ERHAAAQAASTQDADLIRLIQSVFGPMSIASTGRASPARERIPQQKPYETLVHRNPESSL
YNHYRDSFYRNRAYRHRDEQLLQALFDMLDGEQQ
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaagatgtcctgctgcggtgtttctcggcgctctcgcggttctctgcgcgctg
tcttccccaggagtgaacgctttggaccggcagtacctcaacgagtgggccgtggagatc
cccggaggaacggacgctgcgcagtcgatagccaacgagctcggctacgaactggtcaga
cagattggggcgctacaaaaccattatttattcaaacatcagagtcatcctagcaggacc
aagaggagtgcagaccacatcaccaagaggctgtcagaagacgacagggtatcgtgggcg
gagcagcagtatgagaagcagagaagtaagcgagctcctttaggggctgattgtaaagaa
tgctcagtggacaaactcttcgatgatcccatgtggaaccagcagtggtacctgcaagac
acgcggacgtctccgtctctgccgaagctggacctgcacgtgatcccggtgtggaagaag
gggatcacgggtaaaggcgtggtcatcaccgtgctggacgacggcctggagtggaaccac
accgacatctaccccaattacgatcctgcagccagttacgatttcaacgacaacgacccc
gatcctttccccagatacgactccaccaatgagaacaagcacgggacaaggtgtgcaggt
gagattgccatgcaggcggacaacaacaaatgtggagtcggggtggcttacaactctaag
gttggagggatccggatgctggatggcattgtgacggacgccatagaggccagctctata
gggtttaacccggaccacgtggacatctacagtgccagctggggtcctaatgatgacggg
aaaacagtggagggtcctggtcgtctggctcagaaagccttcgagtacggcatccagaag
ggacgtggtggaaagggctctatcttcgtctgggcgtcgggtaacggcgggcggcagggt
gataactgcgactgtgacggctacacagacagcatctacaccatctccatcagcagtgcg
tcacagcagggcctgtccccgtggtacgcagagaaatgctcatccaccctggccacggcc
tacagcagcggagactacaccgaccagaggatcaccagtgctgacttgcacaatgaatgc
accgagacacacaccggaacatctgcctctgccccgctggcagctgggatctttgccctg
gctttggaacagaatccggatctgacctggagggatcttcagcatatagtggtgtggacg
tctgagttcgacccgctggccaataaccccggctggaagaggaacggcgcagggctgatg
gtgaacagccgcttcggtttcggcctgctgaacgctaaagctctggtggatctggcagat
cccaaagtgtggaagcacgtgccggagaaaaagcagtgcatcgtcagagatgacagcttc
caacccagacctctaaaagcagcgggggagatcagcattgagattcccaccaaagcgtgt
gctggccagacaaactctatagagtctctggagcacgtgcaggtggaggccagcattgag
tacacgaggagaggagacctacacatcacactcacttcaccatcaggaactactacagtg
ctgctggctgagcgggagagagacacgtcctccaacggctttagaaactgggacttcatg
tctgtgcacacctggggagagaaccctactggcacctggacactgaaaatcactgacact
tcgggccggatggagaatgaggggcagatactgagctggaagctgattctccacggaacg
tctgaaaagccagaacacatgaagaagccgagagtttacacaccgtacaacgcagtgcag
aatgaccgcagaggagtggaacacatggaggacatgctggaggaggccactgccccttcc
caaaaaatggtaaagtcccgtccaccggctcccattgctgcctcctctcctgccccggag
gagaggcatgcagctgctcaagccgcttccacccaagacgcagacctgatacgcctcatc
cagtcagtcttcggccccatgtctatagcttccactggacgagcttcaccagcgagggaa
aggatccctcagcaaaagccgtacgagaccctggtgcaccgcaaccccgagagcagcctg
tacaaccactacagagacagcttctacaggaaccgggcctaccggcacagagacgagcag
ctgctgcaggccctgttcgacatgctggatggagaacagcagtga

DBGET integrated database retrieval system