KEGG   Astyanax mexicanus (Mexican tetra): 103039178Help
Entry
103039178         CDS       T05042                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
Enzymes [BR:amex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103039178
Cell adhesion molecules and their ligands [BR:amex04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     103039178
   VLA-5
     103039178
   VLA-9
     103039178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
13
AA seq 689 aa AA seqDB search
MYRPTNNFLKVQLNCEKNNKEHRTDDIAPNKLIVRRGKPFQLTFLTERPFQPMQDYFEIT
VETGPNASESKGTKSSFGFQARSGPGKPWSMQLISSTTTSFTVSICPPANACVGLYSLSV
KTTPSSASLTALGSLIILFNPWCEDDSVYMVKEEERREYVMSEQGMLYTGSSDSIHAVGW
DFGQFEDDVIDICLKLLDKNPKCVRNAAEDFSARCSPIYVGRVVSAMINVNDYDNGVLAG
RWDGSYSDGVNPGSWSSSVEILRKWIQNGCGPVKYGQCWVFAAVMCTVLRCLGIPCRVIT
NFDSAHDTNTNLTVDVFINENGVEEKEDSIWNFHVWVEAWMKRPDISDSSLYDGWQVLDP
TPQEKSEGSYCCGPAPLKAILEGHTNLKYDVPFVFAEVNADVVKWIVHPDGSRKKLRTDT
SSVGNRISTKAVGTDRRLDITNLYKHPEGSKAERDDFNNAMRNMGLSEDPAAVVMKIEEV
VKPVTGSDIKLNLTLRNTGSTPQTLILQINAQTMRYTGTPSGNIYKDQKEIQLQPNKEQS
VPITIPFADYGEKMLNNNSIKVSAVAKNAKDPKEVYMADKDIVPHSPPLTITVKGTAVLY
NDLIVEVMFENPLSETLKNCSITLAGSGLLSSPEISQIATLNAGQRVRVIVTFQPYRTGL
KKLVADFQCSNFTKINASCNIDVKPSSRN
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgaccaacaaacaatttcttaaaggtgcagctcaactgtgagaagaacaacaag
gagcatcgcactgatgacatcgctccgaacaaactgatagtgcggagagggaaacccttc
cagctgaccttcctcacagagcggcccttccaaccaatgcaagactacttcgagataact
gtggagacgggtccgaatgcatctgaatcaaaaggcacaaagtcatcttttggatttcaa
gctcgttctggtcctggaaaaccctggagcatgcagctgatcagcagcacaaccacaagc
ttcacagtgtccatctgccctccagccaacgcctgtgtaggactctactctctgtctgtg
aagacgacacccagcagcgcatcattaactgcgttaggatcactgatcattctgtttaac
ccctggtgtgaagatgactctgtgtacatggtgaaggaggaggagaggagggagtatgtg
atgagtgaacaggggatgctgtacacaggcagctcggacagtattcatgctgtaggctgg
gactttggacagtttgaggatgacgttattgacatttgcctgaagctcctggacaaaaat
ccaaaatgtgtaagaaatgcagcagaggatttttctgcacgctgcagccccatctatgtc
ggccgggtggtcagtgccatgataaatgtgaatgattatgataacggcgtgctggcgggg
agatgggacggatcgtacagtgatggggtgaatccggggtcctggagcagcagtgtggag
attttacggaagtggattcagaacggatgtggtccagtgaagtacggacagtgctgggtc
tttgcggctgtcatgtgtacagtgctgaggtgtttaggaattccttgccgcgtcatcacc
aactttgactcagctcacgacaccaacaccaacctcacggtggatgtgtttattaatgag
aatggagttgaggagaaggaagacagtatatggaacttccatgtgtgggtggaggcctgg
atgaagcgacctgatatctctgactcatccttatatgacggctggcaggtcctggatcca
actccacaggagaagagtgaaggatcttactgctgtggtccagctccactgaaggccatt
ctagagggtcacaccaatctgaagtatgacgttcccttcgtcttcgcagaggtaaacgca
gatgtagtgaaatggattgtgcatcctgatggctccaggaaaaagctccggacagacacg
tccagcgtcgggaatcgcatcagcactaaagctgtggggactgacagaagactggacatc
accaacctctacaaacacccagaaggttcaaaagcagaaagagatgatttcaacaacgcc
atgagaaacatgggtctttctgaggatcctgcagccgtagtaatgaagattgaggaggtt
gtaaagccagtaactggatcagatatcaagctgaatttgactctccgtaacactggctcc
acccctcagactcttattctccagataaatgcacagaccatgaggtacaccggaaccccc
tcaggaaacatctacaaggaccagaaagagattcaactacaacctaataaagagcaaagc
gttcccatcaccattcctttcgctgattatggagagaaaatgctcaataacaacagcatt
aaagtttctgcagtggccaagaatgcaaaagaccctaaagaggtttacatggctgacaaa
gacatagtcccacacagcccaccacttactatcacagtgaaaggaacagctgttctgtat
aatgatcttatcgtagaggtgatgtttgagaatcctctgtctgaaaccctgaagaactgc
tccatcacactggcaggaagcggcctgctgtcatcgccggagataagccagattgcgacg
ctcaacgcaggacaaagagtgagagtcatcgtgacgtttcagccctacaggactggcctc
aagaaactggtggctgatttccagtgctcaaacttcactaaaatcaacgccagctgcaac
attgacgtcaaaccatccagccgcaactga

DBGET integrated database retrieval system