KEGG   Astyanax mexicanus (Mexican tetra): 103040258Help
Entry
103040258         CDS       T05042                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103040258 (ace)
Peptidases [BR:amex01002]
 Metallo Peptidases
  Family M2
   103040258 (ace)
Exosome [BR:amex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103040258 (ace)
CD molecules [BR:amex04090]
 Proteins
  103040258 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
4
AA seq 1288 aa AA seqDB search
MQWAVLLLALTGVSMAALKPEWKPGTYPSTEAGAELFVSDYNTTAEQVLSFSTEASWEYN
TNLTNENSLQQIQASMIEQEFTEAWGMKAKATFPDALMETFTNPDLIKIIKKINVLGAAN
LPTAERERYNTILSQMDNIYSTAKVCPKPEECWALEPELKEILANSQSYKKLLYAWEGWH
NVSGIPLKDLYPEFVQLSNNASVMDGFDDTGAYWRSWYESPTFEQDLENLFKQLQPLYQN
LHAFVRRKLYDFYGPKYINLKGPIPAHLLGNMWSQTWNNIYNMMIPFPDKPNVDVTNAMV
EKNYNATHMFRVAEEFFTSLGLKEMPQKFWDKSMLEKPDDGREVVCHASAWDFYNREDFR
IKQCTIVTMEQLFTVHHEMGHVEYYLQYKDQPVSFRRGANPGFHEAVGDVLSLSVSTPKH
LHTIGLLDTLPNDNETDINYLLKMALEKIAFLPFGYLIDQWRWGVFSGRTPPERYNAEWW
YLRTKYQGICPPVRRTEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHQKLCQEAGHTGP
LHTCDIYRSTQAGAVLEKVLQAGSSKPWTEVLQEALGTNKMDAAALMEYFLPVTTWLEEQ
NRLTGETLGWPDFDWMPPVPEGYPEDVADKITDEAQAKQFLAEYNSTAETVWNAYTEASW
SYNTNINEANKQNMLEKNLEMANHTKTYGLEARKYDTSDFQDSSVKRILKKLSDLERAVL
SDDDLKEYNNLLASMETTYSVAKVCKDDGTCLPLDPDLNKIMAESRDYDELLFAWQGWRN
ASGRELRQSYVRYVELANLAARSNGHADNGAFWRSLYETPTFEEDLEALWKDLQPLYLNL
HSYVRRALFKKYGAKRINLKGPIPAHLLGNMWAQTWSGIMDLVRPYPNAAQVDVTQAMIA
KGWDANRMFRESENFFTSVGLLPMPDEFWQKSMLEKPTDGREVVCHASAWDFYNRKDFRI
KQCTVINMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVSTPKHL
HTIGLLDKLEENAESTINFLMSIALDKIAFLPFGYLMDQWRWKVFDGRISSSEYNKEWWN
LRLKYQGLCPPVTRTEVDFDPGAKFHIPANVPYVRYFVSFVVQFQFHKALCDTAGHTGPL
HNCDIYQSKEAGKLLGDVMKLGFSKPWPEAMAMITGQPQMSVQPLMEYFQPLITWLEQEN
AKNGDVLGWPEYSWMPNTAESNSTVVVVEKDSPVNFLGLSVDEAAATAGQWVLLVLGIVL
LLATIFLAYSYRKSRRLQSKSISQMELK
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggccgttctgctgctggccctcacgggagtcagcatggctgctctgaaacct
gagtggaagcccgggacttatccatctacagaggcgggagctgagctgttcgtcagcgac
tacaacaccaccgcagaacaagtcctctccttcagcacggaggccagctgggaatacaac
accaacctgaccaatgaaaactccctgcaacagatccaggcgtctatgatagagcaagaa
tttacagaggcttggggaatgaaggctaaagccacctttcctgacgctcttatggagacc
ttcactaatccagatctcataaaaatcataaagaagatcaatgtgctcggagccgccaac
ctcccaactgcagagagagagaggtacaacacaattctgagtcagatggacaacatctac
tccacggcaaaagtgtgtcctaaaccagaggagtgctgggctttggaacctgagctgaag
gagattttggctaactcccagagctacaagaagctactgtatgcctgggaaggctggcac
aatgtctctgggataccactcaaggacctttatcctgaatttgtccaactcagcaacaac
gcctctgttatggatggttttgatgacacgggtgcttactggcgttcctggtacgagtct
cctacctttgagcaggacttagaaaacctgtttaaacaactgcagccgctttaccagaac
ctgcacgccttcgtccgacgcaagctctacgatttctacggtccaaagtatatcaatctt
aaaggacccatccctgcccatcttctcggtaatatgtggtcacaaacctggaataacatc
tataacatgatgattcctttccctgacaagcctaatgtggatgtgactaatgccatggtt
gagaagaactacaacgccacacatatgttccgggtagctgaagagttcttcacatccctg
gggctcaaggagatgccacagaagttctgggacaaatcaatgctggagaagcctgatgat
ggacgggaggttgtgtgtcacgcctctgcctgggacttctacaaccgtgaggactttagg
atcaagcagtgcactatagtgactatggagcagcttttcactgtacatcatgagatgggc
catgtggagtattacctgcagtacaaagaccagccagttagcttcaggcgtggagccaac
cctggcttccatgaagccgtcggagacgtgctgtctctttctgtctccacacccaaacat
ctacacactattggccttctggacactctgcctaatgataatgagacagacatcaattac
ctattgaaaatggctttggagaagatagctttccttccgtttggatacctcattgatcag
tggcgttggggtgtgttcagtggacgtacgccacctgagagatacaatgcagagtggtgg
tatctcaggacaaaataccaaggaatctgtccaccagtgagacgcacagaagaacacttt
gaccccggagcaaaataccacatcccaggaaatactccttacatcaggtactttgtgagc
ttcattcttcagttccagtttcatcagaagctttgtcaggaggctggacacactggacca
ctgcacacctgtgatatctacagatctacccaggctggagcagttctagagaaagtcctg
caggctggctcctctaagccctggactgaagtgctgcaagaagctttgggcacaaataag
atggacgccgccgccctgatggagtattttctacccgtcaccacctggctagaggaacag
aacaggctgactggagaaactctgggctggcctgactttgactggatgccacctgttcca
gaaggttacccagaagatgttgctgacaagataactgacgaggcgcaggcaaaacagttc
ttggctgagtacaactccacggcagagactgtctggaacgcttacactgaggcctcctgg
tcctacaacaccaacatcaatgaagcaaacaagcagaatatgctggagaaaaacctggag
atggccaatcacacaaagacgtacggactggaggcccgcaagtacgacacctctgacttc
caggactcttcagtgaagaggattctgaagaaactgagtgacctagagagagctgtgctc
tctgatgatgacctgaaggagtacaacaacctgttggcctccatggagacgacttacagt
gtagctaaagtctgtaaagatgatggaacctgtctacctcttgatccagacctgaataag
atcatggctgagtccagagactatgatgagctgctgtttgcctggcagggctggcgcaac
gcttcaggaagagaactgcgccaaagctatgtgagatacgtggagctcgccaatttggct
gcccgcagtaacggtcatgctgacaatggggctttctggcgttccttatatgaaaccccc
acctttgaggaggatctggaagcattatggaaagatctacagccgctctacctcaatctt
cactcttacgtccgccgtgccctcttcaaaaagtacggagcgaaacgcatcaacctcaaa
gggccaatcccagctcatttactaggaaacatgtgggcccaaacgtggtccggcatcatg
gacctggttagaccctaccccaacgccgctcaggtggacgtcacacaagccatgatagcc
aagggctgggatgctaatcgaatgttcagggagtctgaaaacttcttcacgtctgtggga
ctgctgcccatgcctgatgagttctggcagaagtccatgctggagaaacccacagacggc
cgagaggtggtgtgccatgcctctgcctgggacttttacaaccgcaaagacttcagaatt
aagcagtgcactgtgataaacatggatgacctcatcaccgtgcaccatgagatgggtcat
gttcagtacttcctgcagtacaaggaccagcccatctccttccgtgacggtgccaaccca
ggattccatgaggctattggggacgtcttggccctgtcagtgtccactccaaaacatctc
cacaccatcggcctgctggacaaactggaggaaaacgcagaaagcaccattaacttcctg
atgagcattgccttggacaaaattgcattcctgccgttcggctacctaatggaccagtgg
agatggaaggtgtttgatggcaggatatcaagcagcgagtataataaagagtggtggaac
ctcaggctgaagtaccagggtctgtgtcctcctgtaacccgcacagaggtagactttgac
ccaggggcaaagttccacatcccagccaacgtaccctacgtcaggtattttgtcagcttt
gtggttcagttccagttccacaaagctctgtgtgacactgctggccacactggtcctctg
cacaactgtgatatctatcagtctaaagaggcagggaaactgctgggtgatgtgatgaag
ctgggcttcagtaagccctggcctgaggctatggctatgatcactggccagccccaaatg
tctgtgcagcctctgatggagtatttccagcccctcatcacctggctcgagcaggagaac
gcaaagaatggagatgtcctcggatggcctgagtatagctggatgccaaacacagctgag
agtaactctactgtagtggtagtggagaaggacagccccgtgaactttctgggtttgagt
gtggatgaagctgcagctacagctggtcagtgggttctgctggtgctggggatcgtcctc
ctcctcgccaccatcttcctggcctacagttacagaaaatccagacgcctccagagcaaa
tctatctctcagatggagctgaaataa

DBGET integrated database retrieval system