KEGG   Astyanax mexicanus (Mexican tetra): 103043782Help
Entry
103043782         CDS       T05042                                 

Gene name
cdc23
Definition
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:amex00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103043782 (cdc23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    103043782 (cdc23)
   04114 Oocyte meiosis
    103043782 (cdc23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103043782 (cdc23)
Ubiquitin system [BR:amex04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     103043782 (cdc23)
Chromosome [BR:amex03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    103043782 (cdc23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
14
AA seq 578 aa AA seqDB search
MAALSVELQDLVGVKQQLVKIQEQCRERGLVHSAKWASELAFALNPLPLNKLPSPPELTE
EDAQDLDALCLAKSYFDLKEYDRAAYFLRGCRSQKAYFLYMYSRYLSGEKKKDDETVDSL
GPLEKGQVRNEALRELRVELSKKHSAGELDGFSLYLYGVVLRKLDLLKEAVDIFVAATHA
LPLHWGAWLELCNLITNIEMLKSLSLPDCWVRDFFMAHMYTELQMIKEALQKYQSLMEAG
FAKSTYIISQIAVAYHNIRDIDQALDLFNELREQDPFRIENMDTFSNLLYVRSMKPELSY
LAHNLVEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRCLGAWTLMGHEYMEM
KNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYSLYYYRKAHQLRPNDSRMLVA
LGECYEKLSQQVEAKKCYWRAYSVGDVERMALLKLAKLHEQLNESDDAAQSYIIYIQDIF
SCGEQLEHAEVSTALRYLGQYYFKNKLYDEASLCAQRCCDYNDAREEGKALLRQISAVRE
QGEPSSTDLSLPSVFNPLSSNTTPVRRVSPLDLSSVTP
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctcagtgtggagctccaggacctggtcggagttaaacagcagctggtgaag
attcaggagcagtgcagggagcgggggctggtccacagcgctaaatgggcttccgagttg
gcatttgctctcaatcctctcccacttaacaagctgccctcgccgcctgagctgactgag
gaggacgctcaggatctggatgctctctgtctggctaagtcctattttgacctgaaggag
tatgaccgagctgcgtacttcctccgaggctgccgcagtcagaaagcctactttctttat
atgtactcacgctatttgtctggagagaagaaaaaggatgatgagactgtggacagtctg
ggtcctctggagaaagggcaggtgcggaacgaggctctgcgggagctgagggtggagctc
agtaagaagcacagcgctggagagttggatggattctccctctacctgtacggtgtggtg
ctgcggaagctggacctgctgaaagaagctgtggacatctttgtggctgcgactcatgct
cttcctttgcactggggagcctggctggagctctgcaacctcatcaccaatatcgaaatg
ctgaagtccctgtctctgccagactgctgggtgagggacttcttcatggcacacatgtac
actgagctgcagatgattaaagaagcgctgcagaagtaccagagcctgatggaggctgga
ttcgccaagagcacctacatcatctctcagatcgctgtagcttatcacaacatcagagat
atcgaccaagccttagatttgtttaatgaacttcgggagcaggatcctttcagaattgag
aacatggacaccttctccaacctgctgtatgtcaggagcatgaagccagagctgagctat
ttggcccataacctggtggagattgataagtatagagtggagacctgctgtgtgattggt
aattactacagtctgcgctcgcagcacgagaaggcggcgctgtatttccaaagagctctg
aagctgaacccgcgctgcctgggggcctggacgctcatgggtcacgaatacatggagatg
aagaacacttccgctgccatccaagcctacagacacgctatagaggtgaataagagggac
tatcgagcctggtatggacttggacagacatacgaaatcctaaaaatgcctttttactcg
ctctactactacaggaaagcccaccagctcaggccgaatgactcccgcatgctggtggct
ctgggagaatgctatgagaaactctcacaacaggttgaggctaaaaagtgttactggaga
gcgtactctgtaggagacgtggagagaatggcacttctcaaactggcaaaacttcacgag
cagttaaacgagtcagacgacgcagcacaatcttacatcatctacatccaggacattttc
tcctgtggagaacagctggagcatgcggaggtcagcacagctctgcgatatctcggtcaa
tactacttcaagaataaactctatgatgaggcgtctctctgtgctcagcgctgctgcgac
tacaacgatgcgcgtgaggaggggaaggctcttctgaggcagatctctgctgtacgggag
cagggagagccgtcttccactgacctctccttacccagcgtcttcaaccccctctccagc
aacaccacccctgtcagaagagtgtccccactggacctgtcctccgtcacaccctaa

DBGET integrated database retrieval system