KEGG   Astyanax mexicanus (Mexican tetra): 103046152Help
Entry
103046152         CDS       T05042                                 

Definition
(RefSeq) beta-1,3-galactosyltransferase 1-like
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00601  Glycosphingolipid biosynthesis - lacto and neolacto series
amex01100  Metabolic pathways
Module
amex_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:amex00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103046152
Enzymes [BR:amex01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     103046152
Glycosyltransferases [BR:amex01003]
 Glycan extension
  Type 1 chain
   103046152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 103046152
NCBI-ProteinID: XP_007248918
Ensembl: ENSAMXG00000025970
LinkDB All DBs
Position
10
AA seq 329 aa AA seqDB search
MPSKVSCLYLLTVLCWASALWYLSGSRPSSTYVGQMSVPVRKQPPRLLKNVTFSNIRTRT
LNPHSFRFLINEPSKCEGDPPFLLILISTNHKEFDARQAIRETWGEENMYSDIRIVTLFL
LGHNSEPVLNQMVEQESQIFHDIIVEDFEDSYHNLTLKTMMGMRWVSSFCPNAHYVMKTD
SDIFVNMDNLVLNLLRPNAKPRQRFFTGHVINGGPIRDTRSKWYMSREMYPESKYPPFCS
GTGYVFSGDMAELIFKTSLHTRLIHLEDVYVGLCLRKLGIHPIQNSGFNHWKMSYSLCRY
RRVVTVHQISPEEMHRIWNDMSTKKHLKC
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgccctcaaaggtgtcctgtctgtacctactcactgtgctttgctgggccagcgctctg
tggtacctcagcggctcccggccttccagcacctacgtaggccagatgtccgtgccggtc
cgcaagcagccgccaagactcttaaaaaatgtgacctttagcaacatccgcactcgcacc
cttaacccgcacagcttccgcttcctcatcaacgagccaagcaaatgcgagggtgaccca
cccttccttcttatcctgatcagcaccaaccacaaagagtttgacgctcggcaggcgatc
cgggagacgtggggtgaggagaacatgtacagcgacattcgcatcgttacactctttctt
cttggtcacaattccgagcctgtactgaaccagatggtggagcaggagagccagatcttc
catgacatcattgtagaggactttgaggattcctaccacaacctaaccttgaagaccatg
atgggaatgcgctgggtatcctccttctgtccaaacgcccactatgtcatgaagacagac
agcgacatctttgtcaacatggacaatctggttctgaaccttctaagacctaacgctaag
cccaggcagcgcttcttcacagggcatgtcataaatggagggcccatccgagacactcgc
agcaagtggtacatgtctagagagatgtaccctgagagcaagtaccccccgttctgttct
gggactggatacgtgttctcaggggacatggctgagctgatctttaagacttccctgcac
actcgcctcattcacctggaggacgtgtatgtgggcttgtgcttgcgcaagctggggatc
caccccatccagaacagtggcttcaaccactggaagatgagctacagcctctgccgctat
cgcagggtggtcactgtacaccaaatctcaccagaggagatgcacaggatatggaacgac
atgtctaccaaaaagcatctcaagtgctaa

DBGET integrated database retrieval system