KEGG   Alteromonas macleodii English Channel 673: AMEC673_16755Help
Entry
AMEC673_16755     CDS       T02254                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
amg  Alteromonas macleodii English Channel 673
Brite
Translation factors [BR:amg03012]
 Eukaryotic Type
  Elongation factors
   AMEC673_16755
 Prokaryotic Type
   AMEC673_16755
Mitochondrial biogenesis [BR:amg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AMEC673_16755
Exosome [BR:amg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AMEC673_16755
  Exosomal proteins of breast cancer cells
   AMEC673_16755
  Exosomal proteins of colorectal cancer cells
   AMEC673_16755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3927151..3928335)
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKTYGGNAQAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLNEYEFPGDDLPVIQGSALKALE
GDAEWEKKIIELGEALDSYIPEPERAIDKPFILPIEDVFSISGRGTVVTGRVEQGIIKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLAKPGSIT
PHVNFEAEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGAVELPEGVEMVMPGDNLKFK
VELIAPIAMEEGLRFAIREGGRTVGAGVVSKILD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttgaacgtacgaaaccccacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaactaccctaactgcagctatcactacagttctttctaaaacttac
ggcggtaacgcacaggctttcgatcaaatcgataacgcgcctgaagagaaagcacgtggt
atcaccatttctacttcacacgtagaatatgacactcctactcgtcactacgcacacgta
gactgcccaggacacgctgattacgttaaaaacatgatcactggtgctgctcagatggac
ggtggtatcctagtagttgctgcgactgatggccctatgccacagactcgtgagcacatc
ctacttggtcgtcaggttggtattccttacatcatcgtattcatgaacaagtgtgacatg
gttgacgatgaagagcttctagagctagtagaaatggaagttcgtgaacttctaaacgaa
tacgaattcccaggtgatgacctaccagttatccaaggttcagctcttaaagcgcttgaa
ggcgacgcagagtgggaaaagaaaatcatcgagcttggtgaagcgcttgattcatacatc
ccagagccagagcgtgcaatcgacaagccgttcattcttccaatcgaagacgtattctca
atctcaggccgtggtacagttgtaacgggtcgtgttgagcaaggtatcatcaaggttggt
gaagaagtagaaatcgtaggtatcaaagatactactaagactacttgtactggtgttgag
atgttccgtaagcttcttgacgaaggccgtgcaggtgagaacgttggtgttcttctacgt
ggtactaagcgtgatgaagttgagcgtggtcaagtactagctaagcctggttcaatcact
ccacacgttaacttcgaagcagaagtatacgtactatctaaagatgaaggtggccgtcat
actccattcttcaaaggctaccgtccacagttctacttccgtacaactgacgtaactggt
gctgtagagcttccagaaggcgtagaaatggtaatgcctggtgacaaccttaaattcaaa
gttgagctaattgctccgattgcgatggaagaaggtcttcgtttcgcaatccgtgaaggt
ggtcgtacagtaggtgctggtgttgtatctaagatcctagactaa

DBGET integrated database retrieval system