KEGG   Actinosynnema mirum: Amir_3680Help
Entry
Amir_3680         CDS       T00957                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
ami  Actinosynnema mirum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4307375..4315540)
Genome map
AA seq 2721 aa AA seqDB search
MSTRTGTDHVRGRRGTIIDIARRHAEDTPSRPAYLFLADGVTESASHDFAGVDRRARAIA
AELTARGLRGERVLIAYPSGMAYVESFLGCLYAGAVAVPCDSGRGTAGAERLAAIRADAE
PVLALRDPAGGSGQLTGLPALHVADVPDSAAGHWRHPGVGQDEVAFLQYTSGSTRTPSGV
RVTHANVLANEHAIQVACGNDRDSHFVGWLPLFHDMGLIANVLQPLYLGSRSVLMPPEAF
VRSPLAWLRAVERYRARVSGGPNFAYELCLSRIGERDRAGLDLSGWTVAYNGAEPVRHET
LRRFTEGFRSAGFAPTAHFPCYGLAEATLIVTSTPTAEPPTTLRADPAALRAGKLTGVAE
DEPGATLVSCGPAVPGTEVEIVDPVTRSPVPAGGIGEVWLRGDGVAAGYWNRPAETEETF
AAHLAGTRDRPYLRTGDLGALVENRLYITGRRKDVIVIRGENHLPQDLEHTAERAAPALR
PSCGAAIAVDVDGVESVVLCHELISPQEEHDLDAIATRVRRAVAGAHGVECRHVVFVAKG
GIPKTTSGKVRRQLCRLLYLNGELPVLRVVSASRAAAPDLPDLAEIAALDPEARREELAA
ALGRTAAALASDAETAPGADEPLARFGLDSLGAVELRHLVQRRYGVDLGATALADQASPD
DLATLILSADNRKSPAAPEIEGASPDHGPLPLTEGQRALWFEHELDPAGAAYTLSRVLRI
EGPLDPDVLSRALDALVARHPALRTSFPVDQDGPRRLVSPTGPHLQSVDASADADAELTA
RLLELAERPFDLSSAPPFAATLVRRDERTHLLVLVAHHLVMDLWSFLVVLDELRASCEAR
STPVPTTSTGRRDPHETALAETADYLRSPAHDRDRDFWRRALAQAPSALELPADRPRPQH
RDFRGATEGFRLPAELVRDLRAFARQRSCTLFTVLLTAYRALLHRYTGQSDLVLGTLLAG
RDTADLADAVGYFIRTVPLRSRCGREDSFDALLADSGRLLRDAVDHGRYPLRHMVAELSP
DRDAGRPTLVQTQFVLQQEYGERRGGTFGLAQGSEDRVGLGTATITPVELPRRWSQLDLS
LSMAQLGDGLTGCWEYRTGLFDRATVAGMSGHLVELLRALVHDPARLVDAIPLRDAGEVP
EAGPERDRPDLGGLHRVAAEAARAHPDTTAVVAPDGTLSHVALHRAATGVAAGLRALGAL
PGEPVAVLHQRGVALPIAYLGVLHAGCAVLPLDPDDPAPRRAVLLADSGTRFLLTGDDVP
DDGVDLPVRRLDTAALARRPGRGRSTPVHPEQPAYLLYTSGSTGVPKGVLVPHRGIVNRL
RWMQEHYGLAPGERVLHKTPVSFDVSWWELCWPLIAGGTVVLAPPGLHRDPSGLAAFITR
VAVGTAHFVPSALTPFLAESARAGAAASPLRRVLCSGETLPSTTRDRFFQLFDAELHNLY
GPTEASVDVTAWRCSPSEDGPVPIGLPISNTSVAVLDHRLRPVPRPIEGELFLGGVGLAT
CYAADPAKTAAAFVPDPGGTGARLYRTGDRARRRPDGALVFRGRADQQVKIGGQRVELGE
VAEVLRAQPGVTDAAAVVRDARLIGYVRGPDAPAPAELRERLRLLVPARLVPARIVPVDV
LPVTRSGKLDHHALPDPGTDPETGPERWTTRARTPSERALADLWATYLGRPAIDVDTDFF
SLGGDSILAIAVSSAAREAGAGFTVAELMAHPTVASLAAHLDDRPDARDVEAEALAPFAL
RPELAGRGGLADAYPVSMAQRALIAHEGDNPAYEVYATSVVVSAALEPSALAQAVRLVLA
RHPYLRSSFDLTGSAEPMQLVWHDVPRLPLEVLDLSGDPAPEERFSAWLEAERKRHFDLD
HGPLARFTAHDLGPVFRLTTSSFGLDGWCTALVLTEVLHAYREASRGATWSPPPLRTGYA
DFVALERSAISSPEDRAFWAAELRGARPSTLPRWATGSTTRQPTLQQRTVLEVDDHVRDA
LSALGVELGVGLKHVLLGVHLRVVSAATGAEDAVTGLETNGRPERRDGDRVVGVFNNILP
LRVGVPGDASWADLARAAYAAERRTSPHRRYPLITLNREFGAGALFDVLFVFTHFHLYRE
LSAAGGPGISGLQAPDQTYVPLTAHFNVDAESGRLRLLLEADPAKVPAEQVEEFGGLFAA
ALRAAARRPHEAASRWAGSVGASGDHASVPEPGREPAVHELVEAAVHGGPDRIALVEDGK
HLSYRGLWAASARLAEALQAFPVGPDTVVGLWAERGVDYVVGLLAILRAGAAHLSIDPET
PQERVAAVLADARATLLVLPRGVPAPEGVAFGAVLRTSAAPGPGSAGGVRRPRLSGSNLA
CVLATSGSTGRPKLVGVHHYGLVNYLRWCVSAYGITEGTSAPVHSSPAFDLTVTSLLAPL
TAGGVAHLLPGADVTNLGTALLSGRHTLVKITPSHLFAVAGHLAARGRALGGLTVVVGGE
RLDGGQVAAARAVMPDALLFNEYGPTETVVGCSAHRVGAVVEGPVPIGEPITGASAAVLD
ARDGHRGELAVGGVGVTRGYLGLPGATALAFAPDPERPGARRYRTGDLVQRLPGGALVFR
GRADRQVKLRGHRVDLGEIEQALTAHPAVTGAAVLLGNGAAGSARLIAYWSGTSQPSELR
DWLRRRLPARLVPGDLRWLAALPLTGSGKVDHAALAARPEHRERLVDRIELLTDEEAAWL
LRMARGQADRPQEPGGRDDRA
NT seq 8166 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgaaccgggacggaccacgtgcgcgggcgccgcggcacgatcatcgacatc
gcccggcggcatgccgaggacaccccgtcccgccccgcctacctcttcctcgccgacggc
gtgaccgagtcggcgagccacgacttcgccggcgtcgaccggcgggccagggcgatcgcc
gccgagctgaccgccagagggctccggggcgagcgggtgctgatcgcctacccgtcgggc
atggcgtacgtcgagtccttcctcggctgcctgtacgcgggcgctgtcgcggtgccctgc
gactccgggcgggggaccgcgggcgcggagcggctggccgccatccgcgcggacgccgag
cccgtcctcgcgctgcgcgacccggcaggcggctccgggcagctgaccgggctgccggca
ctgcacgtcgcggacgtgcccgacagcgcggccgggcactggcggcatcccggagtcggg
caggacgaggtcgcgttcctccagtacacctcgggctccacccggacaccgagcggggtg
cgggtcacccacgccaacgtcctggccaacgagcacgccatccaggtcgcctgcggcaac
gaccgggactcccacttcgtcggctggcttcccctgttccacgacatgggcctgatcgcc
aacgtcctccagccgctgtacctggggtcacggtcggtgctgatgccaccggaagcgttc
gtccgctctccgctcgcctggctgcgggccgtcgagcgctaccgggcgcgcgtgagcggc
ggccccaacttcgcctacgagctgtgcctgtcgcggatcggcgagcgggaccgcgccggg
ctggacctgtccggctggaccgtcgcctacaacggcgcggagcccgtccggcacgagacg
ctgcgccgcttcaccgagggcttccgctcggccgggttcgccccgaccgcccacttcccc
tgctacggcctggccgaggccaccctgatcgtgacgtcgacgccgacggccgaaccgccc
accacgctccgcgccgacccggccgcgctccgcgcgggcaagctcaccggggtcgccgag
gacgagccgggcgccacgctggtcagctgcggacccgccgtgccggggaccgaggtcgag
atcgtcgacccggtgacccgcagcccggtccccgcgggcggcatcggcgaggtctggctg
cgtggagacggcgtcgcggccgggtactggaaccggcccgcggagaccgaggagaccttc
gccgcgcacctcgcgggcacgcgcgaccggccctacctgcgcaccggtgatctcggggcc
ctcgtggagaacaggctctacatcaccgggcggcgcaaggacgtcatcgtcatccgcggc
gagaaccacctcccgcaggacctggagcacacggccgagcgcgcggctccggcgctgcga
ccgtcctgcggggcggccatcgcggtggacgtcgacggcgtcgagagcgtggtgctgtgc
cacgaactcatctcgccccaagaggagcacgacctcgacgcgatcgccacgcgggtgcgg
cgcgcggtggctggcgcgcacggcgtcgagtgcaggcacgtcgtgttcgtcgccaagggc
ggtatcccgaagaccacgagcgggaaggtgcgcagacagctctgccgcctgctgtacctg
aacggcgagctcccggtgctccgcgtggtcagcgccagccgggccgccgcgccggacctg
cccgacctggcggagatcgccgcgctcgaccccgaagcgcgccgggaggagctggcggcc
gcgctcgggcggaccgccgcggcgctggcaagcgacgccgagacggctccgggagcggac
gagcccctggcgcggttcgggctcgactcgctgggcgcggtcgagctgcggcacctggtg
cagcggcgctacggggtcgacctcggcgccaccgcgctcgccgaccaggcgagcccggac
gacctcgccacgctgatcctgtccgccgacaaccgcaagtccccggccgcccccgagatc
gagggagcgtcgccggaccacggcccgctgccgctcaccgagggacagcgcgccctgtgg
ttcgagcacgagctcgaccccgcgggcgcggcctacaccctctcgcgggttctccggatc
gaggggccgctcgaccccgacgtcctgagccgggcgctggacgcgctcgtcgcgcggcac
ccggcgctgcggaccagcttcccggtggaccaggacggcccccgccgtctggtgagcccg
acggggccccacctccagtcggtcgacgcgagcgcggacgcggacgcggagctgaccgct
cgcctgctcgaactcgcggagcggcccttcgacctgtcctcggcgccgccgttcgcggcg
accctggtgcgccgtgacgagcgcactcacctgctcgtgctggtcgcgcaccacctcgtg
atggacctgtggtcgttcctggtggtgctcgacgagctccgcgcctcgtgcgaggcgcgg
agcaccccggtcccgacgacatcgaccggccgccgcgatccgcacgagaccgcgctcgcc
gagacggcggactacctgcgctccccggcccacgaccgggaccgggacttctggcgccgt
gcgttggcgcaggccccgtccgccctcgaactccccgccgaccgcccccggccgcagcac
cgcgacttccggggcgcgaccgaggggttccgactgcccgccgagctggtgcgcgatctc
cgggccttcgcgcggcagcgttcctgcacgctgttcaccgtcctgctcaccgcctaccgg
gcgctgctgcaccgctacaccgggcagagcgacctggtgctgggcacactgctggccgga
cgggacaccgccgacctcgccgacgcggtcggctacttcatccgcaccgttccgctccgc
tcccggtgcgggcgggaggactccttcgacgccctgctcgccgactcggggcgactgctg
cgcgacgccgtcgaccacggccggtacccgctccgccacatggtcgccgagctgtcgccg
gaccgcgacgcaggccgccccaccctggtgcagacccagttcgtgctccagcaggagtac
ggcgagcgccgaggcgggacgttcgggctggcgcaggggtccgaggaccgggtcggcctc
ggcacggcgaccatcacccccgtcgagctgccccgccgctggtcgcagctcgacctgagc
ctgagcatggcgcagctgggcgacgggctgaccgggtgctgggagtaccgcaccggcctg
ttcgaccgggccacggtggccgggatgtccggacacctcgtcgagctgctgcgcgccctg
gtccacgacccggcgcgcctggtggacgcgatcccgctgcgggacgcgggcgaggtcccc
gaggccgggcccgagcgggaccggccggacctcggcggactccaccgcgtggcggccgag
gccgcgcgcgcccaccccgacacgactgccgtggtcgcgccggacggcacgctgagccac
gtcgccctgcaccgggccgcgaccggggtcgccgccgggctgcgcgccctcggcgcgcta
ccgggcgagccggtcgcggtgctgcaccagcgcggggtcgcgctgccgatcgcctacctc
ggggtgctgcacgccgggtgcgcggtgcttccgctcgacccggacgacccggcgccgcgc
cgcgcggtgctcctggcggatagcgggacgcggttcctgctcaccggggacgacgtgccg
gacgacggagtcgacctgcccgtccggcgtctggacaccgccgcgctggcccgacggccc
ggtcgcggccgctccacgccggtgcaccccgagcagcccgcgtacctgctctacacgtcg
gggtcgaccggcgtcccgaagggtgtgctggtgccgcaccgcggcatcgtcaaccggctg
cggtggatgcaggagcactacgggctcgcccctggggagcgcgtgctgcacaagaccccc
gtcagcttcgacgtctcctggtgggagctgtgctggccactcatcgccggggggaccgtg
gtgctcgcgccacccggactgcaccgcgacccgagcgggctggcggcgttcatcacgcgc
gtcgcggtcggcaccgcccacttcgtgccgagcgcgctcacgccgttcctcgccgagtcg
gcccgcgcgggcgcggcggcctcgccgctgcgcagggtgctgtgcagcggcgagacgctg
ccctccaccaccagggaccggttcttccagctcttcgacgccgagctgcacaacctctac
ggtcccaccgaggcctccgtcgacgtcaccgcgtggcgctgctcgccgtccgaggacggg
ccggtgcccatcggactgccgatcagcaacacctccgtcgcggtgctggaccaccggctc
cgcccggtgccccgcccgatcgagggggagctgttcctcggcggcgtcgggctcgcgacc
tgctacgccgcggacccggccaagacggcggcggcgttcgtgcccgatcccggtgggacg
ggcgcccgcctgtaccgcaccggcgaccgggcgcggcgcagacccgacggcgcgctggtc
ttccgcggtcgcgccgaccagcaggtcaagatcggcggacagcgggtcgagctgggtgag
gtcgccgaggtgctgcgcgcccagccgggggtgaccgacgcggcggctgtggtgcgcgac
gccaggctgatcggctacgtccgaggaccggacgcgcccgcccccgccgaactgcgcgag
cggctgcgcctgctggtgcccgcccggttggtgcccgcccggatcgtgccggtcgacgtg
ctgccggtcacccggagcggcaagctggaccaccacgccctgcccgatccgggaacagat
ccggagaccggtccggagcggtggacgactcgggcgcggacgccctcggagcgcgcgctc
gccgacctgtgggccacctacctgggcaggcccgccatcgacgtggacaccgactttttc
tccctcggaggggactcgatcctcgcgatcgcggtctcgtcggcggcacgggaagccggt
gcgggcttcacggtggccgagttgatggcccacccgaccgtcgcgtcgctggccgcgcac
ctcgacgaccgaccggacgccagggacgtggaggccgaggccctggcgccgttcgcgctc
cgccctgagcttgcggggcgcgggggactggccgacgcgtaccccgtctcgatggcccag
cgagcgctgatcgcgcacgagggcgacaaccccgcgtacgaggtctacgcgaccagtgtc
gtggtctccgccgcgctggaaccgtccgcgctggcgcaggccgtccgcctcgtgctcgcc
cgccacccctacctgcgctcctcgttcgacctgaccggttccgccgagccgatgcagctc
gtctggcacgacgtcccccgcctgccgctggaggtgctggacctgagcggtgacccggcc
cccgaggagcggttctccgcgtggctggaggccgagcgcaagcggcacttcgacctggac
cacggcccgctggcgaggttcaccgcgcatgacctcggcccggtgttccgcctgaccacc
agcagcttcggactcgacggctggtgcaccgcgctggtgctcacggaggtgctgcacgcg
taccgcgaggcgagccgcggcgcgacttggagcccgccgccgctgcggaccgggtacgcc
gacttcgtcgcgctggagcggtcggcgatcagctcgccggaggaccgcgcgttctgggcg
gcggagctgcgcggcgcccgaccgtccaccctgccgcggtgggcgaccggatccacgacg
cggcagccgaccctgcagcagcgcaccgtgctggaggtcgacgaccacgtgcgggacgcg
ctctccgcgctcggggtcgagttgggcgtggggctcaagcacgtcctgctcggcgtgcac
ctgcgggtggtgagcgcggcgaccggtgcggaggacgccgtcaccggcctggagaccaac
ggcaggccggagcgccgggacggcgaccgcgtggtcggcgtgttcaacaacatcctcccg
ctgcgcgtcggggtgcccggtgacgcgagctgggccgacctcgcccgcgccgcgtacgcc
gccgagcgccggacctcgccgcaccgccgctacccgctgatcaccctgaaccgggagttc
ggcgcgggtgcgctgttcgacgtgctcttcgtcttcacccacttccacctctaccgggag
ctgtccgcggcgggcggaccggggatctccgggctccaagcccccgaccagacgtacgtg
ccgctgaccgcgcacttcaacgtcgacgcggaatccggccgcctccggctgctgctggaa
gcggacccggccaaggtgcctgccgagcaggtcgaggagttcggcgggctgttcgcggcg
gcgctccgggctgcggcgcgccgaccgcacgaggccgcgtcgcgctgggcggggagcgtc
ggggcatccggtgaccacgcgtccgttccggaacccggtcgggaaccagccgtgcacgag
ctggtggaggcggccgtgcacggggggccggaccggatcgcgctggttgaggacggcaag
cacctgagctaccgtggcctgtgggcggcgtccgcgcggctcgccgaggcgctccaggcg
ttccccgtcggtccggacaccgtcgtggggctgtgggcggagcgcggcgtggactacgtc
gtggggttgctggcgatcctgcgcgcgggcgcggcgcacctgtcgatcgacccggagacc
ccgcaggagcgggtggccgccgtgctcgccgacgcgagggcgaccctgctcgtgctgcct
cgaggggttccagcgcccgagggcgtcgccttcggagccgtgctgcggacgagcgcggcc
cccggccccggttccgcgggcggggtgcgccgcccgcggctgagcggctcgaacctggcc
tgcgtactggccacgtccggttccaccgggcggccgaagctggtcggcgtccaccactac
gggctggtcaactacctgcgctggtgcgtttccgcctacgggatcaccgaggggacctct
gccccggtgcactcgtcgcccgcgttcgacctcaccgtgacgagcctgctcgcgccgctg
acggccgggggcgtcgcgcacctgctgcctggagcggacgtcacgaacctgggcacggcg
ctgctctccggccgccacaccctggtcaagatcaccccgtcgcacctgttcgcggtcgcc
gggcacctcgccgcgcggggccgcgcgctcggcgggctcaccgtcgtggtgggcggagag
cgactggacggcgggcaggtcgccgccgcgcgggcggtcatgccggacgccttgctgttc
aacgagtacggccccaccgagaccgtggtgggctgctccgcgcaccgggtgggcgctgtg
gtggaggggccggtgcccatcggcgaaccgatcacgggcgcgtcggcggcggtcctggac
gcgcgggacggccatcggggcgagctggctgtcggcggcgtcggcgtcaccaggggctac
ctcggcctgccgggggccaccgcactggcgttcgcgcccgatccggagcggccgggcgcc
cggcgctaccgcaccggcgacctggtccagcggctgcccggtggagcgctcgtcttccga
ggacgcgccgaccggcaggtcaagctgcgcggccaccgcgtggacctcggcgagatcgag
caggcgctgaccgcgcaccccgccgtgaccggcgccgcggtcctgctcgggaacggcgcc
gcgggcagcgcccgcctgatcgcttactggtccggcacatcgcagccctcggagctgcgg
gactggctccggcggcggttgcccgcccgcctggtccccggcgacctgcgctggttggcc
gccctgccgctcaccggcagcggaaaggtcgaccacgctgcgctggccgcgcggccggag
caccgggagcggctggtggaccggatcgaactgctgaccgacgaggaagcggcctggctc
ctgcggatggcgcgcgggcaggcggaccggccgcaggagccaggaggccgcgatgaccga
gcctga

DBGET integrated database retrieval system