KEGG   Actinosynnema mirum: Amir_5868Help
Entry
Amir_5868         CDS       T00957                                 

Definition
(GenBank) peptidase S1 and S6 chymotrypsin/Hap
Organism
ami  Actinosynnema mirum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(6908247..6908978)
Genome map
AA seq 243 aa AA seqDB search
MRVAMALALLLTGVAVAPPAGADPRIVGGVVVDAPNPYPWVVALADQNGRQFCGGAIVSR
YQVVTAAHCVNGLTGRDVLVVAGRLDVTKPGGTVHPVSQVYVHSAYRSATSGADIAYLLT
STPMPYEPIALAKPSETGLYRAGITGTAFGWGRTSESGSTSPVLRKVSVPLQTNEVCAAA
YPGYYQSSSMFCAGLPNGGKDACQGDSGGPFIIAGRLAGLVSWGVGCARPEYPGVYTRVG
VYT
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggcgatggcgctggcactgctgctcaccggcgtggcggtggcgccgcccgcc
ggggccgacccgaggatcgtcggcggcgtggtcgtggacgccccgaacccctatccgtgg
gtggtggcgctggccgaccagaacggcaggcagttctgcggcggcgcgatcgtcagccgg
taccaggtggtgaccgccgcgcactgcgtcaacgggctcaccgggcgcgacgtgctggtg
gtggcgggcaggctggacgtgaccaagcccggcggcacggtccacccggtgtcccaggtg
tacgtccactccgcctaccggtcggcgaccagcggcgcggacatcgcgtacctgctgacg
tccacgccgatgccgtacgagccgatcgcactggccaagccgtccgagaccgggctgtac
cgggcgggcatcaccggcaccgcgttcggctggggccgcacctcggagagcgggagcacc
tcgccggtgctgcggaaggtgtccgtgccgctccagaccaacgaggtgtgcgccgccgcg
taccccggctactaccagtcgtcgtcgatgttctgcgccgggctgcccaacggcggcaag
gacgcctgccagggcgactcgggcgggccgttcatcatcgcgggcaggctcgccgggctg
gtgtcctggggcgtcggctgcgcccggccggagtaccccggcgtgtacacccgcgtcggc
gtctacacctga

DBGET integrated database retrieval system