KEGG   Advenella mimigardefordensis: MIM_c01190Help
Entry
MIM_c01190        CDS       T03016                                 

Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
amim  Advenella mimigardefordensis
Pathway
amim00564  Glycerophospholipid metabolism
amim01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amim00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MIM_c01190
Enzymes [BR:amim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MIM_c01190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA Lycopene_cycl HI0933_like NAD_binding_8 3HCDH_N Pyr_redox_3 Thi4 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AHG62222
UniProt: W0P9S4
LinkDB All DBs
Position
137795..139459
Genome map
AA seq 554 aa AA seqDB search
MTVDSSTLPLITGRAQLLARLAEPKTYDLAVIGGGATGLGVALDAAVRGFSVVLLESHDF
AKGTSSRATKLVHGGVRYLAQGNISLVRDALHERATLLHNAPHIAQPLAFVMPSYKLLDT
PFYGIGLKVYDALAGKAGLGHTQFLNTRQTQALLPTVRSQGLKGGVKYWDGQFDDARLAL
ALARTAARHGALLLNYCAVTKLIHDKGRVAGLICEDGDSGRNYEVRARCVVNAGGPWVDA
LREMDGAQAGRTTRPIVAPSQGVHVVVDRAFLPGDHALLVPKTADGRVLFAVPWLGKVIL
GTTDTPRHDLAREPTPFQAELDFILGEAGHYLSRRPTMADVRSMWVGLRPLVRPQDDDGE
NTKGISREHTVLTSASGMVTVTGGKWTTYRAMAEDVLQACFAAGALPARADGVTVNLPLV
GAPQDGITQHNMHMPQGLHSYGSEAAVVSALPGADHWLTDGLSEAMVRFAVAHEYAITVE
DILARRSRLLFLDARQAAAVAPQVASILQDELQRNDVGLPAFLTLAQQYTGQTLDCVDGP
VLSAQAQKATHGQS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgattcaagtactttaccgttaataaccggacgtgcccaattgctggcccgt
ctggccgaacccaaaacctacgacctggcggttatcggcggcggtgcgaccggcctgggt
gtggcgctggatgcggctgtgcgtggtttttcggtggtgctgctggagtcgcatgacttt
gccaagggcacctcgtcacgggcgaccaagcttgtgcatggtggcgtacgttatttggcg
cagggcaatatctctctggtacgggacgcgctgcacgaacgggccacgctgctgcataat
gcaccgcatatcgcgcagcccctggctttcgtgatgccttcgtacaaactgctggatacg
ccgttctacggcattggcctgaaggtctatgacgcgctggcgggcaaggcggggctggga
catactcagtttttgaacacccgacagactcaggcactattgcctacggtgcggtcgcag
gggctgaaagggggcgtcaaatactgggacggacagtttgacgatgcccggctggcgctg
gcgctggcacgcacggctgcccggcacggagcactgctcctgaactactgcgcggtaaca
aaactgattcatgacaagggacgcgtagcaggactgatctgcgaagatggtgactcgggt
cgcaattatgaggtacgtgcgcgttgcgtggtcaatgctggcgggccatgggttgatgcg
ttgcgagagatggacggcgctcaggcaggtcggactactcgccccatcgtggccccgagc
cagggggtgcatgtggtggttgaccgggcgtttctgccgggtgatcatgcgttgctggtg
cccaagacggccgacggcagggtgctgttcgctgtaccctggctgggcaaagtgattctt
ggcacaacggacacgccccgtcacgacctggcccgtgagccgacaccgttccaggcggag
ctggatttcatcctgggcgaggcggggcattacctgagccggcggcccaccatggctgac
gtgcgcagcatgtgggtcggtctgcgtccgctggtccggccccaggacgatgatggcgag
aacaccaaggggatcagccgtgagcatacggtgctcaccagcgcatctggtatggtgacg
gtcacgggtggcaaatggacgacctatcgcgccatggccgaggatgtgctgcaagcatgc
tttgcagcgggcgcgctgcccgcccgggcggacggcgtcacggttaatctgccgctggtt
ggcgcaccgcaggacgggatcacgcaacacaatatgcatatgccgcaaggcctgcattcc
tacggcagcgaagccgctgtcgttagcgcgctgcccggcgccgaccactggctgaccgac
ggcctgagcgaggccatggtgcgctttgctgttgcccacgaatatgccattactgtagag
gatatattggcgcggcgttcgcgcttgctgtttcttgacgcccgtcaggctgccgctgtt
gcgccgcaggtggcatctatcttgcaggatgaactgcagcgcaatgatgtgggattgccc
gcgttccttacactggcacaacagtacacgggacagacgctggattgcgttgacggaccc
gtcttgtcggcgcaggcgcaaaaagccacccatggacaatcgtga

DBGET integrated database retrieval system