KEGG   Advenella mimigardefordensis: MIM_c14370Help
Entry
MIM_c14370        CDS       T03016                                 

Gene name
cbxS
Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
amim  Advenella mimigardefordensis
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:amim00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MIM_c14370 (cbxS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MIM_c14370 (cbxS)
Enzymes [BR:amim01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MIM_c14370 (cbxS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1642807..1643226)
Genome map
AA seq 139 aa AA seqDB search
MRITQGTFSFLPDLTNEQITKQLQYCLNNGWAVGIEYTDDPHPRNTYWEMFGNPMFDLRD
AAGILQEIEQARKTFPNHYIRVTAFDSTHTVESVVMSFIVNRPENEPGFRLVRQEIDGRR
MRYTIESYAVAASAEGSRY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattacacaaggcaccttttcgtttcttcctgatctgaccaacgaacagattacc
aagcaactgcagtattgcctgaacaacggctgggctgtcggtatcgaatataccgatgat
cctcatccgcgcaacacctactgggaaatgttcggcaatcccatgttcgatctgcgcgat
gccgcaggcatcctgcaggaaatcgaacaggcgcgcaaaacgttcccgaaccactacatt
cgggtgactgcattcgactcaacacacaccgttgaatctgtcgttatgtcattcatcgtc
aatcgccccgaaaacgagccaggctttcgcctggtccgtcaggaaattgacggacggcgc
atgcgctatacgattgaaagctatgccgtggccgccagcgctgaaggcagccgttattga

DBGET integrated database retrieval system