KEGG   Alligator mississippiensis (American alligator): 102559299Help
Entry
102559299         CDS       T03087                                 

Definition
(RefSeq) trypsin-3
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:amj00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102559299
Enzymes [BR:amj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102559299
Peptidases [BR:amj01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102559299
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102559299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 268 aa AA seqDB search
MEMSFWIKDCGFQPRRFPWQLKEEPGYQGGQRKLQRIIGGHIVGPHSAKYLVSLKRMTGS
HFCGGSLVSRSWVLTAAHCKTEINQMLIVAGEYSLSTFEGTEQIFRPSRMVVHPDYSSTT
KNADVMLIKLNRPVVYNAFVSIVPLPQQGATVKEGRLCQVSGWGYTSPIGGRTSDTLRSV
RLPIVPSWKCNASSSYAGFITSNMICAGLSTGGKDACQGDSGGPLVCEGRVFGIVSWGHS
CASPRYPGVYTAVANFQKWIYKTIFRHQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagatgtctttctggatcaaggactgtggcttccagcccaggaggtttccatggcaa
ctgaaagaggaaccaggataccaagggggacagcgcaagctccagcgcatcatcgggggt
cacatcgtggggccgcattctgccaagtacctggtgtcgctgaagaggatgacgggctcc
cacttctgtggcgggtctctggttagtcggagctgggtcctgacggctgctcactgcaag
accgaaataaaccagatgctaatagtagccggtgaatattcgctctccactttcgaaggc
acagaacagattttccggccctcccggatggtggttcacccagactacagctccactacc
aaaaatgcagacgtcatgctgattaagctgaaccggccggtggtctataacgcctttgtt
tccattgtgccacttcctcagcaaggcgctacggtgaaggaaggccgcctctgccaagtc
tccggctgggggtacaccagtcccatcggcgggaggacatcggacaccctacgcagtgtg
cgcctccctatcgtcccctcctggaaatgcaacgcctcgtcctcctatgcaggattcatc
accagcaacatgatttgtgccgggctcagcacagggggcaaagacgcctgccagggggac
tccggtgggccgctggtgtgcgagggccgagtgttcgggatcgtgtcctgggggcacagc
tgtgccagcccgcggtatccaggcgtctacacggctgtagccaacttccagaagtggatc
tacaaaaccatcttcagacaccagtag

DBGET integrated database retrieval system