KEGG   Alligator mississippiensis (American alligator): 102562563Help
Entry
102562563         CDS       T03087                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102562563 (GPD2)
Enzymes [BR:amj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     102562563 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 FAD_oxidored EF-hand_8 GIDA Pyr_redox_2 EF-hand_9 NAD_binding_8 EF-hand_5 FAD_binding_3 HI0933_like Pyr_redox_3 Thi4 EF-hand_4
Motif
Other DBs
NCBI-GeneID: 102562563
NCBI-ProteinID: XP_014455031
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MAFRKAVKGTVLIGGGAIATIFGLSQFSQYRNKHGNLVYIQAAEPANVPMKNHLPAREDQ
LLALQNTSEFDVLIIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDFEQYKMVKEALHERANLLEIAPHLSSPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSQCLKSSYVLSKSRALELFPMLQKDRLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYTEVVHLLKKTDPKSGKERVCGAHCRDVLTGQEFDVKAKCVINATGPFTDSVRKM
DDQEVANICQPSAGVHIVMPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTVAGTTDTPTD
ITPHPIPKEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSISRNH
IVAVSDSGLVTIAGGKWTTYRSMAQDTIDAAVQAHNLMAGSSKTVGLLLQGAKDWSPTLY
IRLVQDYGLESEVAQHLASTYGDKAFEVAKIAQVTGKRWPIVGKRLVSEFPYIEAEVIYG
VKEYACTVVDMISRRTRLAFLNVQAADEALPRIVDIMGKELNWSEQRKKEELAAAKKFLY
YEMGYKAKSEQLTDSSEISLVPSDIERYKKRFHMFDKENKGFITILDVQRVLESISIQID
ENTLHDILNEVDLNKNGQVELDEFLQLMSAIQKGYVSGSRLAVLMKTAEENLHQRVVIPV
DRSGGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcgaaaggcagtaaaaggaactgttctcattggaggaggtgccatagcaaca
atttttggcctctctcaattttctcagtatagaaacaaacatggcaacctcgtatatatt
caagcagcagaacctgcgaatgttccaatgaaaaatcaccttcctgcaagagaagatcag
ctactagctctacaaaacacaagcgaatttgatgtgctaattataggaggaggagcaaca
gggagtggctgcgctttagatgctgttactagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcaggagcactaaattgatccatggtggagtgaga
tatcttcagaaggccatcatgaagttggattttgagcagtacaagatggtaaaagaggca
cttcatgagcgtgccaatttgcttgagatcgctcctcatctgtcctctcctttacctata
atgcttcctgtttacaaatggtggcagttaccatattactgggtgggaataaaactctat
gacctcgtagcaggaagtcagtgtctgaaaagcagctatgtcctcagcaaatcaagagcc
ttggaactttttccaatgttacagaaagacaggcttgtaggagctattgtctactatgat
ggacaacacaatgatgcacgaatgaaccttgccattgccctcactgctgccaggtatggt
gctgccacagccaattacactgaagtggtgcacttgctgaagaagacagatccaaagagc
gggaaggagcgtgtctgtggcgcacattgcagggatgttttaacagggcaggaatttgat
gtcaaagccaagtgtgttatcaatgctacgggacctttcacagactctgtgcgcaaaatg
gatgatcaggaagtagcaaacatctgtcagccaagtgcaggcgtgcatattgtgatgcct
ggttattatagccctgacaacatggggctgcttgacccagccactagtgatggccgagtg
attttcttcctgccgtgggaaaagatgactgttgctgggacaacagatactccaactgat
atcactcctcacccaatacctaaagaagaagatatcaactttattttgaatgaagtgcgc
aactacctgagttgtgatgttgaagtgagaagaggagatgtcttggcagcatggagtggc
attcgtcccctggtcacagatccgaactctaaagacacacagtcaatatctcggaatcac
attgttgctgtcagtgatagtggccttgtaaccatagcaggtgggaaatggacaacctat
cgctccatggcacaggataccattgatgctgctgtccaggctcacaatctcatggcaggc
tccagtaagacagtaggacttttattacagggggcaaaagactggagtcctactctttac
attagactggtccaggattatggacttgaaagtgaggtggctcagcatcttgcttctaca
tatggtgacaaggcttttgaggtggctaaaatagcccaggttactggcaagaggtggcct
attgttggaaaacgtcttgtgtccgaatttccatatattgaagcagaggtgatatatggt
gtaaaagagtacgcctgcactgtagtcgatatgatctcgcgtcgtactcgcctggccttc
ctgaatgtgcaggctgctgatgaagccctaccaagaattgttgatatcatggggaaggaa
cttaattggagtgaacagcggaaaaaggaagaacttgcagctgcgaaaaagtttctgtac
tatgaaatgggatataaggcaaaatcagagcaattaacggacagttctgaaatcagtctt
gtgccttcggatattgaaagatataagaagagattccacatgtttgataaagaaaataaa
ggatttattaccatactggatgtccaacgtgtcttagagagcatcagtattcaaattgat
gaaaatacacttcacgatattttaaatgaagtggatttaaacaaaaatgggcaggtggaa
ctcgatgagtttttacagctcatgagtgctattcagaagggctatgtctctgggagccgg
cttgcagtgcttatgaagactgctgaagagaatctacatcagagagttgtaattccagtg
gatcgaagtggaggtggactgtga

DBGET integrated database retrieval system