KEGG   Alligator mississippiensis (American alligator): 102563656Help
Entry
102563656         CDS       T03087                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102563656 (SUV39H2)
Enzymes [BR:amj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102563656 (SUV39H2)
Chromosome [BR:amj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102563656 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102563656 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 407 aa AA seqDB search
MEGWRGAWYVPCLAAHETLQELCRKENLTCKSIGIANRNLKSYEVEYLCGYKVEEGTEYY
LVKWKGWPESTNTWEPLENLKCPLLLQNFHNDQNEYLSRAKQGKALIMRKHGKALKPAVV
DYIVKKAKQRVALQRWKEELNRKKNHKGMILVENTVDLEGPPLDFYYINEYKPAPGINVI
NGITTGCECSDCPAEKCCPKEAGCLLAYNKYRQLKIQPGLPIYECNSFCRCGPDCPNRIV
QKGTPYSLCIFRTNNGRGWGVKTLQKIKTNSFVMEYVGEVITSEEAERRGQLYDNQGNTY
LFDLDYDSDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDLRLPRIALFSTRPIKA
GEELTFDYQMKGSIDPISDSADALSPARKRTRTVCKCGAVCCRGYLN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggagggctggcgcggagcttggtatgtgccatgtctagctgcacatgagaccctccag
gaattatgtaggaaggagaatctcacatgtaaatccattggaatcgccaacaggaatcta
aagagttatgaggtggaatatttgtgtggctacaaggtagaagagggcacagaatactac
cttgtgaagtggaaaggatggccagaatccacaaatacctgggaacctttggaaaatctt
aaatgcccattgctcctccaaaactttcataatgatcagaatgaatatttatctcgagca
aagcaagggaaggcactaataatgagaaaacatggcaaggctttgaaacctgcagtagta
gattacattgtaaagaaagctaaacaaagagtagctctacagagatggaaagaagaactc
aacaggaagaagaaccataaagggatgattcttgtagaaaacactgtggatcttgagggt
cctcctttagacttttactacattaatgaatataagcctgctccaggaataaatgtgatc
aatggaatcacaactggctgtgaatgctctgattgccctgctgagaaatgttgtcccaag
gaggctggatgtcttttggcttacaataaatataggcagttaaaaatccaaccgggtttg
cccatctatgagtgcaactcattctgtagatgtggtcctgattgtcctaacaggatagta
cagaaaggcacaccttactctctttgcatcttcagaactaacaatggccgtggctgggga
gtaaaaaccctccagaaaattaaaacaaacagttttgtgatggaatatgttggagaggtc
attacgagcgaggaagcagagagacgaggccaactgtatgacaaccaaggaaatacgtat
ttgtttgatctggactatgactcggatgaatttacagtagatgcagctcgatatggaaat
gtgtcccattttgtgaatcacagttgtgatccaaatcttcaggtgttcaatgttttcatc
gacaaccttgatttgcgtcttcctcggatagcactgttttctacaagacctatcaaggct
ggagaggagctcacatttgattatcagatgaaaggctctatagatcctatttcggactcc
gctgatgctctcagcccagccagaaagaggaccagaactgtgtgcaagtgtggggctgtg
tgttgtagagggtatcttaactga

DBGET integrated database retrieval system